KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0840Help
Entry
SeD_A0840         CDS       T00757                                 

Definition
(GenBank) acyl-CoA thioester hydrolase YbgC
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SeD_A0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-ProteinID: ACH75116
Position
837835..838239
Genome map
AA seq 134 aa AA seqDB search
MNKYMFRWPIRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQQVLLAERVAFVVR
KMTLEYYAPARLDDMLEVQTEITSMRGTALVFTQRIVNAENTLLNEAEVLIVCVDPLKMK
PRALPKSIVAEFKQ
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtatatgtttcgatggccaattcgagtttattacgaagacacggacgccggc
ggtgtggtttatcacgccagctatgtcgctttttatgaaagagcgcgcacggagatgctg
cgtcaccatcacttcagccaacaggtgctgctggcggagcgggtcgcctttgtggtgcgc
aagatgacgctggaatactatgcgcctgcgcggctcgacgatatgcttgaagttcaaaca
gaaattacgtcaatgcgtggcaccgctttggttttcacgcaacgcattgtcaacgcagag
aacacgctgctaaatgaagcagaggttctgattgtttgcgttgatccactcaaaatgaag
cctcgtgcgcttcctaagtctattgtcgcggagtttaagcagtga

DBGET integrated database retrieval system