KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0854Help
Entry
SeD_A0854         CDS       T00757                                 

Definition
(GenBank) putative homeobox protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbgS PARM
Motif
Other DBs
NCBI-ProteinID: ACH73956
Position
complement(847250..847636)
Genome map
AA seq 128 aa AA seqDB search
MKMTKLTTLLLTATLGLASGTALAAESNAQSSNGQANSAANAGQVAPDARQNVAPNDVNN
NDINTNGNTNSTMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETGNGVNNDVN
TKTDGTTQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgacaaaactgactacgcttttactcaccgctaccctcggccttgccagcggc
acagcgttagctgctgaatctaacgcgcaatccagtaatggccaggcgaactcggcggca
aatgccggtcaggttgccccggacgcccgccagaatgtggcgccgaatgatgtgaataac
aacgacatcaataccaacggcaatactaacagcacgatgcagcatccagacggttcaacc
atgaatcatgacggaatgaccaaggatgaagagcataaaaataccatgtgtaaagacggt
cgctgcccggatattaataaaaaagtggaaaccggtaatggcgtcaataatgacgtgaat
accaaaaccgacggtaccacacagtaa

DBGET integrated database retrieval system