KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0880Help
Entry
SeD_A0880         CDS       T00757                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00030  Pentose phosphate pathway
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
sed_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SeD_A0880
Enzymes [BR:sed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     SeD_A0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: ACH77622
UniProt: B5FP52
Position
873362..874357
Genome map
AA seq 331 aa AA seqDB search
MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQVQPMVVSPDKRYLYVGVRPEFRV
LAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAGNVSVTRLQDGLPVELV
DVVEGLDGCHSANITPDNRTLWVPALKQDRICLFTLSDDGHLVAQEPAEVNTVEGAGPRH
MVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTLDMMPADFSDTRWAADIHITPDG
RHLYACDRTASLITVFSVSEDGSVLSVEGFQPTEAQPRGFNIDNSGKYLIAAGQKSHHIA
VYEITGTQGLLTEKGRYAVGQGPMWVVVNAY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacagtctataccgccagccctgagagtcagcaaattcacgtctggagcctg
aaccacgaagggacgctgacgctggtgcaggtcgtggatgtgcccggtcaggttcagccg
atggtggtcagtccggataaacgctacctctatgtcggcgtgcgcccggagtttcgtgtc
ctggcgtatcgtattgcgccggatgatggcgcgctgacgtttgccgccgaatccgccctg
ccgggtagcccgacccatatttctaccgatcatcatggtcgttttgtctttgtcggatcg
tataacgccggtaatgtcagcgtgacgcgcttacaggatggcctgccggttgagttggtg
gatgtggtggaggggctggacggctgccactcggcaaatattacgcctgataaccgtacc
ctgtgggtgcctgcgctaaaacaggatcgcatttgtctgtttacgctaagcgatgacggc
catctggtggcccaggagccggcggaagtaaatacagttgaaggggcaggcccgcgtcat
atggtcttccacccgaatcgacaatatgcgtattgcgtcaatgaactgaacagttcggtg
gatgtctggcagcttaaaaatccgcatggcgagatagagtgcgtgcaaacgctggatatg
atgcccgccgatttttccgatacccgctgggcggcggatattcatattacgccggatgga
cggcatctgtatgcctgtgaccgcaccgccagtctgattaccgtctttagtgtctccgaa
gatggcagcgtactgagcgttgaaggcttccagccgacggaagcccaaccgcgcggcttt
aatatcgacaatagcggaaaatacctgattgctgcgggtcaaaaatcacatcatatcgcg
gtctatgaaattacgggcactcaggggttgctgacggaaaaaggccgttatgccgtcggc
caggggccaatgtgggttgtggtgaacgcgtactaa

DBGET integrated database retrieval system