KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0886Help
Entry
SeD_A0886         CDS       T00757                                 

Gene name
hutH
Definition
(GenBank) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00340  Histidine metabolism
sed01100  Metabolic pathways
Module
sed_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SeD_A0886 (hutH)
Enzymes [BR:sed01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     SeD_A0886 (hutH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_aromatic
Motif
Other DBs
NCBI-ProteinID: ACH74277
UniProt: B5FP58
Position
880837..882357
Genome map
AA seq 506 aa AA seqDB search
MNTMTLTPGQLSLSQLYDVWRHPVQLRLDASAIDGINASVACVNDIVAEGRTAYGINTGF
GLLAQTRIADEDLQNLQRSLVLSHAAGVGDPLDDAMVRLIMVLKINSLARGFSGIRLSVI
EALIALVNAGVYPLIPAKGSVGASGDLAPLAHLSLTLLGEGKARWQGEWLPAQTALKKAG
LEPVALAAKEGLALLNGTQASTAFALRGLFEAQELFASAVVCGALTTEAVLGSRRPFDAR
IHAARGQQGQIDVARLFRHLLTDTSAIAESHHHCHKVQDPYSLRCQPQVMGACLTQLRQT
KEVLLAEANAVSDNPLVFADAGEVISGGNFHAEPVAMAADNLALAIAEIGALSERRIALM
MDKHMSQLPPFLVKNGGVNSGFMIAQVTAAALASENKALAHPHSVDSLPTSANQEDHVSM
APAAGRRLWEMAANTRGIIAVEWLAACQGIDLREGLTSSPLLEQARQTLREQVAHYTQDR
FFAPDIECATALLAQGALQRLVPDFM
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgacactcactccggggcagttaagcctctctcaactgtacgatgtctgg
cgtcatccggtacagcttcggctggacgccagcgccattgacggcattaacgccagcgtc
gcgtgcgtcaatgatatcgttgccgaagggcgtaccgcctacggcatcaacaccggtttc
ggcctgctggcgcagacgcgcatcgctgatgaagacttgcaaaatctacagcgatcgttg
gtgctgtctcacgccgcgggcgtaggcgacccactggatgacgcgatggtgcgtctgatc
atggtattgaaaatcaatagcctggcgcgcgggttttccggaattcggttgagcgtgata
gaagcgctcatcgctctggtgaatgccggcgtgtatccgctgattccggcaaaaggctcg
gttggcgcgtcgggcgacttagcgccgctggcgcatctgtcgctgacgctgcttggcgaa
ggaaaagcgcgctggcagggcgaatggcttccggcgcagacggcgctaaaaaaggccgga
ctggagcctgtcgcgctggcggccaaagaggggctggcgctgcttaatggcacccaggca
tcaacggccttcgcgctgcgcggtttgtttgaggcacaggagttatttgcctccgccgtt
gtctgcggcgcgctgactaccgaagccgtactgggatcgcgccgtccttttgatgcgcgc
attcatgccgcgcgcggacaacaggggcaaattgacgtcgcgcggttgttccggcacctg
ctgaccgataccagcgccattgctgaatcacatcaccactgtcataaagttcaggacccg
tattcccttcgctgccagccgcaggtaatgggcgcttgtctgacccagttacgtcagacg
aaagaggtactgctggctgaggccaacgcggtatccgataatccgctggtctttgccgat
gcgggggaggtgatctccggcggtaacttccatgctgaaccggttgccatggcggcggat
aatttggcgctggcgatagcggaaatcggcgcgctatcggagcggcgcatcgcgctgatg
atggataaacatatgtcgcagttaccgccgttcctggtgaaaaatggcggcgttaattcc
ggttttatgattgcccaggtcaccgccgcggcgctcgccagcgagaataaagcgctggcg
cacccgcacagcgtggatagcctgccgacctcggcgaatcaggaagatcatgtctcaatg
gccccggcggcagggcggcgactctgggaaatggcggcgaatacccgcggcatcattgcc
gtggagtggctggcggcctgtcaggggatagatttacgggaagggttaacctccagcccg
ttactggaacaggcgcggcagacactgcgcgagcaggtggcgcactatacgcaggatcgt
tttttcgcgcccgatattgagtgtgcgacggcgctgctggcgcaaggcgcgttacagcgt
ctggtgccggactttatgtga

DBGET integrated database retrieval system