KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0891Help
Entry
SeD_A0891         CDS       T00757                                 

Gene name
bioC
Definition
(GenBank) biotin biosynthesis protein BioC
  KO
K02169  malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00780  Biotin metabolism
sed01100  Metabolic pathways
Module
sed_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SeD_A0891 (bioC)
Enzymes [BR:sed01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.197  malonyl-[acyl-carrier protein] O-methyltransferase
     SeD_A0891 (bioC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_8 TehB Methyltransf_29 MTS CMAS NodS FtsJ
Motif
Other DBs
NCBI-ProteinID: ACH75566
Position
886529..887284
Genome map
AA seq 251 aa AA seqDB search
MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFASVLDAGCGPGRMSRYW
RERGSEVTALDLSLPMLQQARDRQAAHHYLLADIEAIPHDAGVFDLAWSNLAVQWCGDLR
DALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRAHANSFLPEEAIDHALRGWRA
SRHTQAMTLWFEDALSAMRSLKGIGATHLHEGRETDVLTRARLRQIQLAWPQRQGKYPLT
YHLFMGVIERD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtgaataagcaggctattgcggcggcgtttggccgggccgcatcgcaatac
gaacagcacgcctctttacagcaacacagcgcggatgcgctgctgacgctgttgacaggc
cgccagtttgccagtgtgttggacgcaggctgcggccccggacgtatgagtcgttactgg
cgagagcgggggagcgaagtgaccgccctggatctttcgctgccgatgctgcaacaggct
cgcgatcgtcaggcggcgcatcactatttgctggcggatatcgaagcgattccccatgac
gccggcgtttttgacctggcctggagcaacctggcggtccagtggtgcggcgatttacgc
gatgcgttgagcgagttgtatcgggttgtacggcccggcggcgtggtggcgtttaccacc
ttgtgccaggggtcgttgccggagctgcgtcaggcatggcaggccgtcgataatcgcgct
cacgcgaatagctttttgccggaagaggccattgaccacgcgctacgcggctggcgggcg
tctcgtcatactcaggcgatgacattgtggtttgaggatgccctgagcgcgatgcgttcg
ctcaaaggcattggcgccacccatcttcatgaagggcgggagacggatgtattaacccgc
gcccggcttagacagattcaactggcatggccgcagcggcaggggaaatatccgctgacg
taccacctttttatgggagtgattgaacgtgactaa

DBGET integrated database retrieval system