KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0893Help
Entry
SeD_A0893         CDS       T00757                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  excinuclease ABC subunit B
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sed00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SeD_A0893 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sed03400]
    SeD_A0893 (uvrB)
DNA repair and recombination proteins [BR:sed03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SeD_A0893 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SeD_A0893 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB Helicase_C ResIII UVR AAA_30 DEAD UB2H IF2_N
Motif
Other DBs
NCBI-ProteinID: ACH74274
UniProt: B5FP65
Position
888614..890635
Genome map
AA seq 673 aa AA seqDB search
MSKPFKLNSAFKPSGDQPDAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMLIDQRAILRRLAELQ
YTRNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQVESTVPR
YTIYPKTHYVTPRERILQAMEEIKDELADRRKVLLANNKLLEEQRLSQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGDEVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRQRAAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGKGKGRSTAKAGIVELDMTPKALQQKIHELEGQMMQHAQNLEFEEAAQIRD
QLHQLRELFIAAS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccgttcaaactgaattccgcttttaaaccttctggcgatcagccggacgct
atacgtcgtctggaagaggggctggaggacgggctggcgcatcagacgttattgggcgtg
accggctccgggaagacattcaccattgccaacgtcattgcggacttgcagcggccaacg
atggtgcttgcgcccaataaaaccctggcggcgcagctctacggcgaaatgaaagagttt
ttcccggaaaacgcggtggagtatttcgtctcctactatgactactatcagccggaagcg
tatgtgccaagttcggatacgtttatcgaaaaagacgcttcggtaaacgaacatattgag
caaatgcggttgtcggcaacgaaagcgttgcttgagcgacgcgatgtcgtggtggtggct
tccgtgtccgcgatttacggtctgggcgatccggatctctacctgaaaatgatgctgcat
ctgacggtgggaatgctgattgaccagcgcgcgattttgcgtcggctggcggaattgcaa
tacacccgtaacgatcaagcttttcagcgtggtacctttcgcgtgcgcggcgaagtgatc
gacatcttcccggctgaatctgacgacatcgcgctacgcgttgagctgtttgatgaagaa
gtggaacgcctgtcgctgttcgacccgttaaccgggcaggtagagtcaacggtgccacgt
tatactatctatcccaaaacgcactacgtgacgccgcgcgagcgtattctgcaggcgatg
gaagagataaaagatgagctggcggacaggcgtaaggtcttgctggcgaataataagctg
cttgaagagcagcgattaagccagcgcacgcagttcgatttagagatgatgaacgagctg
ggctactgctcaggcattgaaaactattcccgctttctgtcgggccgcgggccgggcgaa
ccgccgccaaccttgttcgattatctgcccgccgacggactgctggtggtggatgagtct
catgtcaccatcccgcagataggcggcatgtaccgcggcgaccgggcgcgcaaagagacg
ctggtcgagtatggcttccgtctgccttcggcgctggataaccgtccgctgaagtttgag
gagtttgaagccttagcgccgcaaactatctatgtttccgccacgcccggcaactatgag
ctggaaaaatctggtgatgaggtggtggatcaggtcgtgcgaccgaccgggctgctggac
ccgattattgaagtgcgtccggtggcgacccaggtggacgatctgctgtccgaaattcgt
cagcgtgcggccattaatgagcgtgtccttgtcactacgcttaccaaacggatggcggaa
gatttgaccgaatatctggaagagcacggcgagcgcgtgcgttacctgcactcagatatt
gataccgtggagcgcatggaaatcatccgcgatttgcgtctgggcgagtttgacgttctg
gtggggattaacctgctgcgcgaagggctggatatgccggaagtctcgctggtggcgatt
ctggacgccgataaagagggcttcctgcgctccgagcgctccctgattcagaccataggg
cgcgcggcgcgtaacgttaacggtaaagcgattctgtatggcgataaaatcacgccgtcg
atggcgaaggcgattggcgaaaccgagcgacgtcgcgagaagcagcagaagtacaacgaa
gagcacggtatcactccgcaggggctgaacaaaaaagtggtcgacatcctggcgctgggg
cagaacattgcgaaaaccaaagcgaaggggaaaggcaagggccgttctacggcaaaagcc
ggaattgtcgaactggatatgacgccgaaagcgttgcagcagaaaattcatgaactggaa
gggcaaatgatgcagcacgcgcaaaatctggagtttgaagaagccgcgcaaattcgcgac
cagttgcaccagttacgcgagttgtttatcgcggcgtcctga

DBGET integrated database retrieval system