KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0894Help
Entry
SeD_A0894         CDS       T00757                                 

Definition
(GenBank) leucine-rich repeat protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NEL TTSSLRR LRR_4 LRR_8 WYL Sif Yopt SYCE1
Motif
Other DBs
NCBI-ProteinID: ACH78057
Structure
PDB: 

Position
891125..893392
Genome map
AA seq 755 aa AA seqDB search
MFNITNIQSTARHQSISNEASTEVPLKEEIWNKISAFFSSEHQVEAQSCIAYLCHPPETA
SPEEIKSKFECLRMLAFPAYADNIQYSRGGADQYCILSENSQEILSIVFNTEGYTVEGGG
KSVTYTRVTESEQASSASGSKDAVNYELIWSEWVKEAPAKEAANREEAVQRMRDCLKNNK
TELRLKILGLTTIPAYIPEQITTLILDNNELKSLPENLQGNIKTLYANSNQLTSIPATLP
DTIQEMELSINRITELPERLPSALQSLDLFHNKISCLPENLPEELRYLSVYDNSIRTLPA
HLPSGITHLNVQSNSLTALPETLPPGLKTLEAGENALTSLPASLPPELQVLDVSKNQITV
LPETLPPTITTLDVSRNALTNLPENLPAALQIMQASRNNLVRLPESLPHFRGEGPQPTRI
IVEYNPFSERTIQNMQRLMSSVDYQGPRVLFAMGDFSIVRVTRPLHQAVQGWLTNLEEED
VNQWRAFETEVNAAAFSMFLDRLSDTRNTRHPDFKEQVSAWLMRLAEDSALRETAFIIAM
GATISCEDRVTLAYHQMQEATLVHDAERGAFDSHLAELIMAGREIFRLEQIESLAREKVK
RLFFIDEVEVFLGFQNQLRESLSLTTMTQDMRFYNVSGITESDLDEAEIRIKIAENRDFH
KWFALWGPWHKVLERIAPEEWREMMAKRAECIETDEYQSRVNAELEALGIAGDPDAERMA
GMRIMEEINQTLFTEIMENILLKKEVSSLMSAYWR
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatattactaatatacaatctacggcaaggcatcaaagtattagcaatgaggcc
tcaacagaggtgcctttaaaagaagagatatggaataaaataagtgcctttttctcttca
gaacatcaggttgaagcacaaagctgcatcgcttatctttgtcatccacctgaaaccgcc
tcgccagaagagatcaaaagcaagtttgaatgtttaaggatgttagctttcccggcgtat
gcggataatattcagtatagtagaggaggggcagaccaatactgtattttgagtgaaaat
agtcaggaaattctgtctatagtttttaatacagagggctataccgttgagggaggggga
aagtcagtcacctatacccgtgtgacagaaagcgagcaggcgagtagcgcttccggctcc
aaagatgctgtgaattatgagttaatctggtctgagtgggtaaaagaggcgccagcgaaa
gaggcagcaaatcgtgaagaagccgtacaacggatgcgtgactgcctgaaaaataataag
acggaacttcgtctgaaaatattaggacttaccactatacctgcctatattcctgagcag
ataactactctgatactcgataacaatgaactgaaaagtttgccggaaaatttacaggga
aatataaagaccctgtatgccaacagtaatcagctaaccagtatccctgccacgttaccg
gataccatacaggaaatggagctgagcattaaccgtattactgaattgccggaacgtttg
ccttcagcgcttcaatcgctggatcttttccataataaaattagttgcttacctgaaaat
ctacctgaggaacttcggtacctgagcgtttatgataacagcataaggacactgccagca
catcttccgtcagggattacccatttgaatgtgcagagtaattcgttaaccgctttgcct
gaaacattgccgccgggcctgaagactctggaggccggcgaaaatgccttaaccagtctg
cccgcatcgttaccaccagaattacaggtcctggatgtaagtaaaaatcagattacggtt
ctgcctgaaacactacctcccacgataacaacgctggatgtttcccgtaacgcattgact
aatctaccggaaaacctcccggcggcattacaaataatgcaggcctctcgcaataacctg
gtccgtctcccggagtcgttaccccattttcgtggtgaaggacctcaacctacaagaata
atcgtagaatataatcctttttcagaacgaacaatacagaatatgcagcggctaatgtcc
tctgtagattatcagggaccccgggtattgtttgccatgggcgacttttcaattgttcgg
gtaactcgaccactgcatcaagctgtccaggggtggctaaccaatctcgaggaggaagac
gtcaaccaatggcgggcgtttgagacggaagtaaacgcggcagccttcagcatgtttctg
gatcgtcttagcgatacgcggaacacccgacacccggattttaaggaacaagtctccgcc
tggctaatgcgcctggctgaagatagcgcactaagagaaaccgcatttattatagcgatg
ggtgcaacgataagctgtgaagatcgggtcacactggcataccaccaaatgcaggaagcg
acgttggttcatgatgctgaaagaggcgcctttgatagccacttagcggaactgattatg
gcggggcgtgaaatctttcggctggagcaaatagaatcgctcgccagagaaaaggtaaaa
cggctgttttttattgacgaagtcgaagtatttctgggttttcagaatcagttacgagag
tcgctgtcgctgacaacaatgacccaggatatgcgattttataacgtttcgggtatcact
gagtctgacctggacgaggcggaaataaggataaaaattgctgaaaatagggattttcac
aaatggtttgcgctgtgggggccgtggcataaagtgctggagcgtatagcgccagaagag
tggcgtgaaatgatggccaaaagggctgagtgtattgaaacggatgagtatcagagccgg
gtcaatgctgaactggaagcgttaggaatagcaggtgatcctgacgcagagcgcatggct
ggaatgcggataatggaagagatcaatcagaccctctttactgagatcatggagaatata
ttgctgaaaaaagaggtgagctcgctcatgagcgcctactggcgatag

DBGET integrated database retrieval system