KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0897Help
Entry
SeD_A0897         CDS       T00757                                 

Gene name
moaB
Definition
(GenBank) molybdenum cofactor biosynthesis protein B
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00790  Folate biosynthesis
sed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SeD_A0897 (moaB)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     SeD_A0897 (moaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ACH74465
Position
895800..896312
Genome map
AA seq 170 aa AA seqDB search
MSQVSAEFIPTRIAILTVSSRRGEEDDTSGHYLRDSAQEAGHEVVAKAIVKENRYAIRAQ
VSAWIASDEVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTATLQ
SRAVAGVANNTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggtcagcgctgaatttatcccgacccgcatcgctattcttactgtttccagc
cgacgcggcgaagaagacgacacctccggtcattatctgcgtgattcggcgcaggaggcc
gggcatgaagtggtggcgaaagccatcgttaaagagaaccgttacgcgattcgcgcccag
gtttccgcctggatcgccagtgatgaggtgcaggtcgtattgataactggcgggaccggt
ttgaccgaaggcgatcaggcgccggaagcgctgttgccgctgttcgatcgtgaagtggaa
ggatttggcgaagtgtttcgcatgctctcgtttgaagagatcggcaccgcaactctgcag
tcgcgcgcggtagctggcgtggcgaataacaccttgattttcgccatgccgggctccaca
aaagcgtgcagaaccgcatgggagaatatcattgcgccgcagctggatgcccgtacacgc
ccatgtaattttcaccctcatttaaagaaataa

DBGET integrated database retrieval system