KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0920Help
Entry
SeD_A0920         CDS       T00757                                 

Definition
(GenBank) C4-type zinc finger protein, DksA/TraR family
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-dskA_traR DZR Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: ACH78040
Position
complement(915152..915418)
Genome map
AA seq 88 aa AA seqDB search
MASGWANDDAVNEQINNTIEDAVARARGELPHGESRDECESCGDPIPEARRKAVPGVRLC
ISCQQEKDLHNATFSGYNRRGSKDSQLR
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggctgggcaaatgacgacgcagtgaatgaacaaatcaacaataccattgaa
gatgccgttgcccgcgctcgcggcgaacttccccacggcgaaagtcgcgatgaatgcgaa
tcgtgcggcgaccctatccctgaagcgcggcgtaaagccgtaccgggcgttcggttatgc
atatcctgccagcaggagaaagatttacataacgcaacattttcaggatataatcgcaga
ggttcaaaagacagccagttacgctga

DBGET integrated database retrieval system