KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0921Help
Entry
SeD_A0921         CDS       T00757                                 

Definition
(GenBank) putative methyltransferase YbiN
  KO
K06970  23S rRNA (adenine1618-N6)-methyltransferase [EC:2.1.1.181]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.181  23S rRNA (adenine1618-N6)-methyltransferase
     SeD_A0921
Ribosome biogenesis [BR:sed03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    SeD_A0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_10 MTS
Motif
Other DBs
NCBI-ProteinID: ACH74698
UniProt: B5FP91
Position
915623..916549
Genome map
AA seq 308 aa AA seqDB search
MSAQKPGLHPRNRHQHRYDLAALCQTTPELTSFLIRTPAGEQSVDFANPQAVKALNKALL
AHFYAVTHWDIPPGFLCPPVPGRADYIHHLADLLGETTGSIPAQATILDVGVGANCIYPL
IGVHEYGWRFTGSEVSDAAMSSAQAIIQANTGLSRAIRLRRQKDPAAIFTGIIHKNEFYD
ATLCNPPFHDSAAAARAGSERKRRNLGQNKDDALNFGGQQQELWCEGGEVAFIKKMIAES
QSFRRQVLWFTTLVSRGENLPPLYRALTEAGAVKVVKKEMAQGQKQSRFIAWTFMDDDQR
RRFITRKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccagaaaccggggttacacccgcgcaaccgccaccaacaccgttatgatctc
gccgcactgtgtcagaccacgccggaattgacgtcctttcttatccgcacgcccgccggt
gaacagagcgttgattttgctaatccgcaagcggtaaaagcgctcaataaggcgttgctg
gcgcatttttatgccgttacacactgggacattccgccagggtttttatgtccgccggtg
cctggtcgtgcggattatatccatcatctggcggatctgcttggcgaaacgacagggagt
attccggcgcaggcaactattctggacgtgggggtgggcgccaattgtatttatccgctt
atcggcgtacatgaatatggctggcgatttaccggtagtgaagtcagcgacgcagcgatg
tccagcgcgcaggctatcattcaggctaatacggggttaagccgcgccattcgtctgcgt
cggcaaaaagatccggcggccatttttaccggtattattcataaaaatgaattttatgac
gcaacgctttgtaacccgccttttcacgactccgccgccgcagcccgcgcgggcagcgag
cgtaagcgccgcaatttggggcagaataaagatgatgcgctgaactttggcggtcaacag
caggagctatggtgtgaaggcggcgaagtcgcctttattaaaaaaatgattgctgaaagc
caatccttccgccgtcaggtgttgtggtttacgacgttggtgtcgcgcggcgagaattta
ccaccgctttaccgggcgttgacggaggctggcgcggtgaaagtggtgaaaaaagagatg
gcccaggggcaaaagcaaagccgctttatcgcctggacctttatggatgacgaccagcgt
cgccgttttatcacccgtaaacgctaa

DBGET integrated database retrieval system