KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0922Help
Entry
SeD_A0922         CDS       T00757                                 

Definition
(GenBank) transporter, small conductance mechanosensitive ion channel
  KO
K22044  moderate conductance mechanosensitive channel
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Pores ion channels [TC:1]
   SeD_A0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel
Motif
Other DBs
NCBI-ProteinID: ACH73987
Position
complement(916546..918768)
Genome map
AA seq 740 aa AA seqDB search
MRWTLFILFCLLGAPAHAVAIPGVTTGTSTSQQAAPEPSPEQKKAAYAALADVLENEASR
NELIAQLREASTTPPTEPAPALAPPAAKDEKTVLENVTTVTRQYGDAFATRFAQLYRNIT
DAPHKPFNSQTFTNALTHFLFLAVAVFGFYSVIRLCALPLYRKMGLWARKKNRERSNWLQ
LPAMIVGAFIIDLLLLALTLFIGQMLSDNFHAGSRTIAFQQSLFLNAFALIEFFKAILRL
IFCPNVPELRPFAIQDATARYWNRRMSSLSSLIGYGLIVAVPIISNQVNVQVGAMANVAI
MLCITIWALYLIFKNKAEITQHLLSLAERSLAFFSLFIRAFALVWHWLASAYFIVLFFFS
LFDPGNSLKFMMGATVRSLAIIGIAAFISGIFTRWIAKTITLSPHTQRNYPELQKRLNGW
LSSALKVARFLTVCVAVMLLLNAWGLFDFWHWLHYGAGEKMVDILIRIALILFFSAVGWT
ILASLIENRLASDIHGRPLPSARTRTLLTLFRNALAVIISTITIMIVLSEIGVNIAPLLA
GAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVRQD
TGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKANQALKDAVTALMETEDIRGL
IIGEPTFAGIVGLTNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLANVRAPVQTYQV
LPAPAGGPPPDSLPPREPTI
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggaccctgttcatccttttttgtctactgggcgcacctgcccatgcggtcgcc
atacccggcgtgaccacggggacatcaaccagccagcaagcagcgccagagcccagtcct
gaacaaaaaaaagcggcctatgcggccctggctgacgtactggagaacgaggcttcacgt
aacgaattgatagcgcaactccgcgaagcctcaaccacgccgccgaccgagccagcgcca
gcgcttgcgccgcctgcggccaaagatgagaaaacggtactggagaacgtcaccaccgtt
acccgtcagtacggcgatgctttcgctacccgtttcgcccagctttatcgcaacatcacc
gatgcgccgcacaagccgtttaactcgcaaaccttcaccaacgcgttaacccacttttta
tttctggccgtcgcggtatttggtttttatagcgtgatacggctttgcgccctgccgtta
tatcgaaaaatgggcctgtgggcacgcaagaaaaaccgtgaacgcagcaactggttacag
ctcccggcgatgatcgtcggcgcgtttattatcgacctcctgctactggcgctcacctta
tttatcggtcagatgctcagtgataatttccatgcgggaagtcgaactatcgcttttcag
caaagcctgttcctgaatgccttcgcgctaatagagttctttaaagcgattctgcggctt
attttttgccctaatgtaccggagttacgcccattcgcgattcaggatgcgacagcgcgt
tactggaatcgccgtatgagttcccttagcagcttgattggctacgggctgattgttgcc
gttccgattatttccaaccaggtgaatgttcaggttggcgcgatggctaatgtggcgatc
atgctctgcatcaccatctgggcgctgtacctgatctttaaaaacaaagcggagattacg
caacatttattaagtctggcggaacgatcattagccttttttagcctgtttatccgcgcc
tttgcgctggtgtggcactggctggccagcgcttactttatcgtgctgtttttcttctcg
ttattcgacccaggcaatagcctgaagtttatgatgggcgcgaccgtgcgcagtctggcg
attattggcatcgcggcgtttatctccggtatttttacccgctggatagcgaaaaccatc
accctgtcgccccatacgcagcgcaactacccggaattacaaaagcggcttaacggctgg
ctctcctcagcgctaaaagtcgcacgctttttgaccgtctgcgtcgccgttatgctgttg
ctcaacgcctgggggctattcgatttctggcactggctacattatggcgcgggggaaaag
atggtcgatatccttatccgtatcgcgttaatcttattcttctccgccgtgggatggacg
atcctcgccagtctgattgagaatcgtctggcctccgatattcatggccgcccgctaccc
agcgcccgcacgcgcacgctgctgacgctgttccgcaatgcgctggcagtgattatcagt
accataaccatcatgatcgtgttatcggaaatcggcgtcaatatcgcgccattgctggct
ggcgcgggggcgttaggtctggctatctctttcggttcgcaaaccttggtgaaagatatt
attaccggcgtctttattcagtttgaaaacgggatgaataccggcgacttagtcaccata
ggcccgctgacggggacggtcgaaagaatgtcgattcgttccgtcggcgtgcggcaggat
accggggcataccatattatcccgtggtcctcgatcaccactttcgccaactttgtgcgc
ggtatcggctcagttgtcgccaactatgacgtggatcgccatgaggatgcggataaagcg
aatcaggcgctgaaagacgcggtaacggcgctgatggagacggaggatattcgcgggctg
attatcggcgaacccacgttcgccggtattgtcggtttaacgaacacggcgtttacttta
cgcgtatcgttcaccaccctaccgctcaagcagtggacggtgcgttttgcccttgatagc
caggtgaaaaagcattttgatctggctaatgtgcgcgcgccggtgcaaacgtatcaggtt
ctgcccgcccccgccggcggcccgccgcctgattcactgccgccgcgcgaaccgacgatt
tag

DBGET integrated database retrieval system