KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0924Help
Entry
SeD_A0924         CDS       T00757                                 

Gene name
glnP
Definition
(GenBank) glutamine ABC transporter, permease protein
  KO
K10037  glutamine transport system permease protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Module
sed_M00227  Glutamine transport system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SeD_A0924 (glnP)
Transporters [BR:sed02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter [MD:M00227] [OT]
    SeD_A0924 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACH74444
Position
complement(919606..920265)
Genome map
AA seq 219 aa AA seqDB search
MQFDWSAIWPAIPLLLEGAKMTLWISVLGLAGGLVIGLAAGFARTFGGWFANHIALVFIE
IIRGTPIVVQVMFIYFALPMAFNDLRIDPFSAAVVTIMINSGAYIAEITRGAVLSIHKGF
REAGLALGLSRRETIRHVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI
IAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgactggagcgccatctggcccgccattccgcttttgcttgagggcgctaaa
atgaccctgtggatctcggtcctcggtctggctggcggcctggttattggactggcggca
ggttttgcccgtacgtttggcggctggttcgccaaccacatcgccctggttttcattgaa
attattcgcggcacgcccatcgttgtccaagtcatgtttatctactttgccctgccgatg
gcatttaatgatttgcgtattgatccgttcagcgcagcggtcgtgacaattatgattaac
tccggcgcttatatcgcggaaattactcgtggcgcagtactatccattcacaaaggtttt
cgcgaagcgggtctggcgctgggcctttctcgccgggaaaccatccgccatgttatttta
ccgcttgctctgcgccgtatgctgccgccgctgggcaatcagtggatcattagcatcaaa
gacacctcgttgtttattgttatcggcgtagccgagctgacccgtcagggccaggaaatt
attgccggtaactttcgcgccctggaaatctggagcgccgtggccgtcttctatttgatc
attacgctggtgctgagctttattttgcgtcgtcttgaaagaaggatgaaaatcctgtga

DBGET integrated database retrieval system