KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0936Help
Entry
SeD_A0936         CDS       T00757                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 AAA_29 RsgA_GTPase SMC_N MMR_HSR1 ArgK RNA_helicase AAA_18 NACHT AAA_24 AAA_28 DUF87 AAA_14 AAA_22 AAA_16 FtsK_SpoIIIE Septin Roc BRE1 AAA_15
Motif
Other DBs
NCBI-ProteinID: ACH76950
Position
929153..930745
Genome map
AA seq 530 aa AA seqDB search
MLVSSNVTMQFGSKPLFENISVKFGGGNRYGLIGANGSGKSTFMKILGGDLEPTLGNVSL
DPNERIGKLRQDQFAFETFTVLDTVIMGHGELWEVKQERDRIYALPEMSEEDGYKVADLE
VKYGEMDGYSAEARAGELLLGVGIPLEQHYGLMSEVAPGWKLRVLLAQALFSNPDILLLD
EPTNNLDIDTIRWLEQVLNERDSTMIIISHDRHFLNMVCTHMADLDYGDLRVYPGNYDEY
MTAATQARERLLADNAKKKAQIAELQSFVSRFSANASKSRQATSRARQIDKIKLEEVKAS
SRQNPFIRFEQDKKLFRNALEVEALTKGFDNGPLFKNVNLLLEVGEKLAVLGTNGVGKST
LLKTLVGDLDADHGTVKWSENARIGYYAQDHEYEFENDLTVFEWISQWKQEGDDEQAVRS
ILGRLLFSQDDIKKPAKVLSGGEKGRMLFGKLMMQKPNILIMDEPTNHLDMESIESLNMA
LELYQGTLIFVSHDREFVSSLATRVIEITPERVVDFSGNYDDYLRSKGIE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgttagtttccagcaacgttaccatgcagttcggcagtaagccgctgttcgaaaacatt
tccgtcaaatttggcggcggcaaccgttacggcctgatcggcgccaacggtagcggaaag
tccacttttatgaaaatcctcggcggcgacctggagccgacgctgggcaatgtttccctc
gatccgaatgagcgcatcggtaagctgcgtcaggaccagttcgcttttgaaacattcacc
gtacttgatactgtcattatggggcatggcgaactgtgggaggtcaagcaggagcgcgac
cgtatctacgccttgccggaaatgagcgaagaagacggctataaagtcgccgatctggaa
gtaaaatacggcgagatggacggttattccgctgaggcgcgtgcgggcgaactgctgttg
ggggtgggcatcccgctggagcagcattacggtctgatgagtgaagtcgcgccaggctgg
aaattgcgtgtgctgctggcgcaagcgttattctctaacccggacatcctgttgctcgac
gaaccgaccaacaacctggatattgatactatccgttggctggagcaggtgctgaacgag
cgcgatagcacgatgatcatcatttcgcacgaccgtcacttcctgaacatggtttgtacg
catatggcggatctggattacggcgacttgcgcgtctatccgggtaactatgatgagtat
atgacggcggcgacccaggcgcgtgaacgtctgttggccgataatgcgaagaaaaaagcg
caaattgccgagctgcaatcttttgttagccgttttagcgccaatgcctctaaatcgcgt
caggcaacgtcgcgcgcgcggcagattgataaaatcaagctggaagaggtgaaagcctcc
agccgtcagaacccgttcatccgttttgagcaggataaaaaactgttccgtaacgctctg
gaagtggaggcgctgacgaaaggttttgataacggtccgctgtttaaaaatgtcaatttg
ctgctcgaagtcggcgagaagctggcggtactcggcaccaatggcgtgggtaaatctacg
ctgctgaagacgctggttggcgatctggacgccgatcacggcaccgttaaatggtcggaa
aacgcgcgtattggttactacgcgcaggaccacgaatatgaattcgaaaatgacctgacg
gtgtttgaatggataagtcagtggaagcaggaaggcgacgacgagcaggcagtgcgcagt
attctgggccgcctgttatttagccaggatgatatcaaaaagcctgcgaaagtcctctcc
ggtggcgagaagggccgtatgctgttcggcaaactgatgatgcaaaagccgaatatcctg
atcatggacgaaccgactaaccacctggatatggagtcgatcgaatcgctgaatatggcg
ctggagctgtatcagggcacgctgatctttgtttcgcacgaccgtgagttcgtcagctcg
ctggcaacccgcgtcattgaaattacgccggagcgcgtggtggacttcagcggcaactac
gacgattatttgcgtagtaaagggatcgagtaa

DBGET integrated database retrieval system