KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0944Help
Entry
SeD_A0944         CDS       T00757                                 

Definition
(GenBank) formate C-acetyltransferase 3
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00620  Pyruvate metabolism
sed00640  Propanoate metabolism
sed00650  Butanoate metabolism
sed01100  Metabolic pathways
sed01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeD_A0944
   00640 Propanoate metabolism
    SeD_A0944
   00650 Butanoate metabolism
    SeD_A0944
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SeD_A0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical DUF3029 YscO
Motif
Other DBs
NCBI-ProteinID: ACH74179
Position
complement(935466..937898)
Genome map
AA seq 810 aa AA seqDB search
MTQLKLDTLSDRIKAHKTALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHL
AERTIWIKHDELIVGNQASEVRAAPIFPEYTVSWIEKEIDDLADRPGAGFSVSEENKRIL
HDVCPWWRGQTVQDRCYGMFTDEQKGLLATGIIKAEGNMTSGDAHLAVNFPLLLEKGLDG
LRDKVAERRSRINLTVLEDLHGEQFLKAIDIVLDAVSQHITRFAALARQMAGEESRESRR
KELLTIAENCEVIAHQPPQTFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPYYRRD
VELNQTLDREHAIELLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLINGQPM
DAVNPLSYAILESCGRLRSTQPNLSVRYHAGMSNDFLDACVQVIRCGFGMPAFNNDEIVI
PEFIKLGIEPQDAYDYAAIGCIETAVGGKWGYRCTGMSFINFIRVMLAALEGGRDATSGK
VFLPQEKALSAGNFNNFDEVMAAWDTQIRYYTRKSIEIEYVVDTMLEENVHDILCSALVD
DCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAVKKLVFEQGVIGQQQLAAALADDFD
GLTHEQLRQRLINGAPKYGNDDDSVDTLLARAYQTYIDELKQYHNPRYGRGPVGGNYYAG
TSSISANVPFGAATMATPDGRKAHTPLAEGASPASGTDHLGPTAVIGSVGKLPTGSILGG
VLLNQKLNPTTLENESDKQKLMVLLRTFFEVHKGWHIQYNIVSRETLLDAKKHPDQYRDL
VVRVAGYSAFFTALSPDAQDDIIARTEHML
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactgaaactggacacgctcagtgaccgcattaaggcgcacaaaaccgcgctg
gtacatatcgtgaaaccgccggtctgtaccgagcgcgcgcaacattataccgaaatgtat
cagcaacatctggataaaccgattccggtacgccgcgcgctggcgctggcccatcacctg
gcggaacgcactatctggataaaacacgatgaactgatcgtcggcaaccaggcaagtgaa
gtccgcgccgcgccgattttcccggaatataccgtctcgtggattgaaaaagagatcgac
gacctggcagaccggcccggcgcaggtttttccgtaagtgaagaaaacaaacgtattctg
cacgacgtctgtccgtggtggcgcggtcaaaccgtccaggatcgctgctacggcatgttt
accgatgaacaaaaagggcttctggcgactggcattatcaaagccgaaggcaatatgact
tccggcgatgcgcacctggcggtgaacttcccgctgctgctggaaaaagggcttgatggc
ctgcgcgataaagtcgccgagcgccgctcacgcatcaacctgaccgtgctggaagatctg
catggcgagcagttcctgaaggcgattgatattgtgctggacgcggtaagccagcacatc
acgcgctttgccgcgctggcgcgccagatggcgggcgaagagtcccgtgaaagccgtcgt
aaagagctacttaccatcgccgaaaactgcgaggtgatcgcccaccaaccgccgcagacc
ttctggcaagcactgcaattgtgctacttcatccaactgattctacaaattgagtctaac
ggtcactcggtgtcatttggtcgtatggaccagtatctttacccctattatcgtcgcgat
gtcgaactaaaccagacgctggatcgtgagcacgccattgaactgctgcacagctgctgg
ctgaaactgctggaagtaaacaagatccgctccggttcgcactctaaagcctccgcgggc
agcccgctgtatcaaaacgtcaccattggcggtcagaatctcatcaacggtcagccaatg
gacgcagtgaatccgctgtcttacgccattctggagtcctgtggacgtctgcgttctacc
cagcccaacctcagtgtgcgttatcacgccggaatgagtaacgatttccttgacgcctgc
gtccaggtcatccgctgcggctttgggatgccggcgtttaacaatgatgaaatcgtcatc
ccggaatttatcaagttggggatcgaaccacaggacgcttacgattacgcggcgatcggc
tgtatcgaaaccgccgtcggcgggaaatggggttatcgctgcaccggcatgagctttatt
aacttcatccgcgtcatgctggcggcgctggaaggcggtcgcgacgccaccagcggcaag
gtatttctgccgcaggaaaaggcgctctccgcaggcaactttaacaattttgacgaagtg
atggccgcctgggatacccaaattcgctactacacgcgcaaatcgatcgaaattgagtat
gtggtcgacaccatgttggaagagaacgtccacgatattctctgctcagcgctggtagac
gactgtattgaacgcgcgaagagtatcaagcaaggcggcgctaaatatgactgggtatcc
ggtcttcaggtcggtatcgccaacctgggcaacagcctcgccgccgtgaaaaaactggtc
ttcgaacagggcgttatcggtcaacagcagcttgccgccgcgctggccgatgactttgac
gggctgacccatgagcagctgcgccagcgtctgattaacggcgcgccgaagtacggtaac
gacgatgacagtgtcgataccctgctggcgcgcgcttatcagacctatattgatgagctg
aagcaataccataacccgcgctatggtcgtggccctgtgggcggcaactattacgccggt
acgtcctctatctcagcaaacgtgccatttggcgccgcgactatggctaccccggatggt
cgcaaagcgcatacgccgctggcggaaggcgcaagccctgcatcgggtacggatcatctc
ggcccgacggcggtgatcggttccgtaggcaaattacctaccggttccattctcggcggc
gtgctgctcaatcagaaactgaacccaacgacgctggaaaacgaatccgacaaacagaaa
ctgatggttctgctacggacgttctttgaggtgcataaaggctggcatattcagtacaac
atcgtgtcacgcgaaacgctgttggatgcgaaaaaacatccggaccagtaccgcgatctg
gtcgtgcgtgtggcaggctactccgccttcttcaccgcgctgtcgccggatgcgcaggac
gatatcatcgcccgtaccgaacatatgctgtaa

DBGET integrated database retrieval system