KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0947Help
Entry
SeD_A0947         CDS       T00757                                 

Definition
(GenBank) molybdopterin biosynthesis protein MoeA
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00790  Folate biosynthesis
sed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SeD_A0947
Enzymes [BR:sed01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     SeD_A0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-ProteinID: ACH74683
Position
complement(939830..941065)
Genome map
AA seq 411 aa AA seqDB search
MEFSAGLMPLETALTQMLSRITPLTAVETLPLVNCFGRILATDIVSPLDVPGFDNSAMDG
YAVRMADLSADKPLPVAGKAFAGQPYQGEWPAGTCIRIMTGAPVPTGCEAVVMQEQTEQT
DDGVRFTADVRCGQNIRRRGEDIRQDAVVFPAGTRLTTAELPVLASLGIADAQVVRKVRV
ALFSTGDELQLPGQPLEAGQIYDTNRLTIHLMLQQLGCEVINLGIIPDDPGKLRAAFVDA
DSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPGKPFAFGKLSNSWFCGLPGN
PVSAALTFYQLVQPLLAKLGGNTASAVPPRQRVRTASRLKKTPGRLDFQRGILQRSANGE
LEVTTTGHQGSHIFSSFSLGNCFIVLERERGNVEPGEWVEVEPFNALFGGL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaattttccgccggattaatgccgcttgaaacggcgctgacccagatgctttcacgt
ataaccccgctcaccgctgtagaaacgttgccgctggtgaactgctttggccgcatcctg
gcgaccgatatcgtttctcccctcgatgtccccggctttgataattcagctatggatggt
tatgcggtacgtatggcggatttgtccgccgataagccgctgcccgtcgccggcaaagca
tttgccggtcagccttaccagggagagtggcctgcgggcacctgcattcgcattatgacc
ggcgccccggtgccgacaggttgcgaggcggtagttatgcaagagcagacggaacaaacc
gatgacggcgtgcgttttaccgccgatgttcgttgcggacaaaacatccgccgccgcggc
gaggatattcgccaggatgcggtggtctttccggccggtacgcgcctgactactgccgaa
ctgccagtgctggcgtcgctgggaattgccgatgcacaggttgtacgtaaagtgcgcgta
gcgctgttctcgaccggcgacgagctccagcttccgggccagccgctggaggcgggacaa
atttatgacactaaccgtctaactatacatttgatgctgcaacagcttggctgcgaagtg
atcaatttaggcattattcctgacgatcccggtaagcttcgcgccgcgtttgtcgacgcc
gacagccaggccgatgtagtgataagctccggcggcgtctcggttggtgaagcggactat
accaaaaccatccttgaggagctgggcgaaatcgccttctggaagctggctatcaagcca
ggcaaaccgtttgccttcggcaagctcagtaatagctggttctgtggcctgccggggaat
ccagtctctgcggcgctcactttttatcaactggttcagcccttactggcgaagcttggc
ggcaacacggcaagcgcagtgccgccgcgccagcgtgtacgcacagcatctcgcctgaag
aaaacgccggggcgtctcgatttccagcgcggcattctgcaacgtagcgccaacggcgaa
ctggaggtcacgaccaccggacaccagggttcacatattttcagctcgtttagtctgggc
aactgctttattgtgctggagcgtgaacgcggcaatgttgagccgggagaatgggtggaa
gtcgagccgtttaatgctctgttcggaggcctgtaa

DBGET integrated database retrieval system