KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0948Help
Entry
SeD_A0948         CDS       T00757                                 

Definition
(GenBank) putative L-asparaginase
  KO
K13051  beta-aspartyl-peptidase (threonine type) [EC:3.4.19.5]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     SeD_A0948
Peptidases [BR:sed01002]
 Threonine Peptidases
  Family T2
   SeD_A0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase_2
Motif
Other DBs
NCBI-ProteinID: ACH76808
Position
941269..942210
Genome map
AA seq 313 aa AA seqDB search
MNKAVIAIHGGAGAIARAQMSHEQELRYIQALSEIVESGQKMLEAGDSALDVVMEAVRLL
EACPLFNAGIGAVYTRDGTHELDACVMDGNTLKAGAVAGVSHVRHPVLAARLVMERSPHV
LMVGEGAENFAFSQGMARVSPDIFSTPARYEQLLAARAAGEMALDHSGAPLDETKKMGTV
GAVARDKFGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRTL
AAYDIAALMEYGGLSLADACERVVMEKLPALGGSGGLIAVDHEGNVALPFNSEGMYRAWG
YAGDTPTTGIYRE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcagtgattgcgattcacggcggcgcaggcgcgattgctcgcgcgcaaatg
agccatgagcaggagctacgctatatccaggcgttgtcagagattgttgaaagcgggcaa
aagatgctggaagcgggtgacagcgcgcttgatgtagtgatggaagcggtgcgtctgctg
gaagcgtgtccgctcttcaatgcgggtatcggcgcggtctatacccgagacgggactcat
gaactggatgcctgcgtgatggacggcaataccctgaaagccggagccgtcgcgggcgtg
agtcatgttcgccatcctgtgctcgccgccaggctggtgatggagcgcagcccgcatgta
ctcatggtgggggaaggggcggaaaattttgccttttcacaggggatggcgcgcgtttcg
ccggatatcttttccaccccggcgcgttacgagcaattgctggcggcgcgtgcggcgggt
gaaatggcgctcgatcacagcggcgcgccgctggacgaaacgaaaaaaatgggtacagtc
ggcgcggtggcgcgggataaattcggcaatctggcggcggcaacgtctaccggcgggatg
accaataaattgcccgggcgcgtcggcgacagcccgctggtcggcgccgggtgttatgcc
aacaacgccagcgtcgccgtttcctgtaccggaacgggagaggtctttattcgcacgctc
gcggcttacgatatcgccgcattgatggaatatggcggactcagccttgccgacgcctgt
gagcgcgtggtgatggaaaaattaccggcgctgggcggcagcggtggattaatcgccgtt
gatcacgaaggtaatgtcgcgttgccgtttaacagcgaagggatgtatcgcgcctgggga
tatgccggggatacgcctaccacaggaatttaccgggaataa

DBGET integrated database retrieval system