KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0950Help
Entry
SeD_A0950         CDS       T00757                                 

Definition
(GenBank) glutathione-binding protein GsiB
  KO
K13889  glutathione transport system substrate-binding protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Module
sed_M00348  Glutathione transport system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SeD_A0950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sed02000]
    SeD_A0950
Transporters [BR:sed02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Glutathione transporter [MD:M00348] [OT]
    SeD_A0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 Ssl1
Motif
Other DBs
NCBI-ProteinID: ACH75585
Position
944125..945663
Genome map
AA seq 512 aa AA seqDB search
MTQFITHKWLAALGLASSIAAFPALAAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQ
GLFGLDKDMKVKNVLAKGYTVSDDGLTYTITLRQGVKFQDGADFDAAAVKANLDRASNPD
NHLKRYNLYKNIAKTEVVDPATVKITLKQPFSAFINILAHPATAMISPQALEKYGKDIGF
HPVGTGPYQLETWNQTDFVKVKKFAGYWQQGLPKLDSITWRPVTDNNTRAAMLQTGEAQF
AFPIPYEQAALLAKNKNLELVASPSIMQRYISMNVTQKPFDNPKVREALNYAINRQALVK
VAFAGYATPATGVVPPSIAYAQSYQPWPYDPAKARELLKEAGYPDGFSTTLWSSHNHSTA
QKVLQFTQQQLAQIGVKARITAMDAGQRAAEVEGKGQKESGVRMFYTGWSASTGEADWAL
SPLFASQNWPPTQFNTAFYSNKQVDSDLAAALKTNDPQEKTRLYKEAQDIIWKESPWIPL
VVEKLVSAHSKNLTGFWIMPDTGFSFDDADLK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatttattacgcataaatggctggcggcgctgggactggcctcatccattgcg
gcttttccggccctggcggccaaagatgtggtggtggcggtagggtctaatttcaccacg
ctcgatccgtatgacgccaacgatacgctctcgcaggcggtggcgaagtcattttatcag
gggctgtttggcctggataaagacatgaaggtaaaaaacgtcctggcgaaaggctatacc
gtttctgatgacggtctgacctacaccattaccctacggcagggggtgaaatttcaggac
ggcgcggattttgatgcggcggcggtgaaagcgaatctcgatcgcgccagcaatccggat
aaccacctcaagcgttataacctgtataaaaatatcgcaaaaacggaggtcgtcgatccg
gcaacggtaaaaattaccctgaaacagccgttctccgctttcattaatattctggcgcac
ccggcgacggcgatgatctcgccgcaagcgctggaaaaatatggcaaggatattggtttt
catccggtcggtaccggtccataccagcttgaaacctggaatcagaccgactttgtcaaa
gtgaagaagttcgccggttactggcagcagggcttacccaagctggattctattacctgg
cgtccggttactgacaacaatacccgcgcggcgatgctgcaaaccggcgaagcgcaattt
gcttttcctatcccttatgagcaggccgcgttattggcgaaaaataaaaacctcgaactg
gtcgccagcccgtccattatgcagcgttatatcagtatgaatgtgacgcagaagccgttt
gataatcctaaggtgcgtgaggcgttgaattacgctatcaatcgtcaggcgctggttaaa
gtggcgtttgccggatacgccacgccggcgacgggcgtggtgccgccgtcgatagcctat
gcgcaaagctatcagccatggccctatgatccggctaaagcgcgcgaactgttgaaagag
gcggggtatccagacggtttcagtaccacgctgtggtcatcgcacaaccatagcaccgcg
caaaaagtgttgcagtttacccaacagcaactggcgcagattggcgttaaagcccggata
accgcgatggacgccggccagcgcgccgcggaagtcgagggcaaagggcaaaaagagagc
ggcgtgcgaatgttctatacaggctggtcggcgtcgacgggcgaagctgactgggcgtta
tcgccgctcttcgcatcacaaaactggccgccgacgcagtttaataccgctttttacagc
aacaagcaggtcgacagcgatttggcggcggccttaaagaccaacgatccgcaggagaaa
acacgattgtacaaagaggcgcaggatattatctggaaagagtcgccctggataccgttg
gtggtggagaaattggtttctgcgcacagtaaaaatttgaccggtttctggattatgccg
gataccggtttcagctttgacgatgcggatttgaagtaa

DBGET integrated database retrieval system