KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0952Help
Entry
SeD_A0952         CDS       T00757                                 

Definition
(GenBank) glutathione transport system permease protein GsiD
  KO
K13891  glutathione transport system permease protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Module
sed_M00348  Glutathione transport system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SeD_A0952
Transporters [BR:sed02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Glutathione transporter [MD:M00348] [OT]
    SeD_A0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF624
Motif
Other DBs
NCBI-ProteinID: ACH77036
Position
946647..947558
Genome map
AA seq 303 aa AA seqDB search
MRLFNWRRQAILHAMPVVKPDQIRTPWREFWRRFRRQHVALVAGGFVLALILVAIFARWL
TPYDAENYFDYDSLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAIIGT
VLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPK
IKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgattatttaactggcgccgtcaggcgattttacatgctatgccggtggtaaaaccc
gaccagatacgcacgccgtggcgggagttctggcgtcgttttcgccgccagcatgtcgcg
ttggtcgccgggggattcgtactggcgttaattctggtggcgatttttgcccgctggctg
acgccctacgatgcggaaaactattttgactacgatagcctgaacaatggcccctctttg
cagcactggtttggcgttgactcgctgggaagagatatctttagccgggttctcgttggg
gcgcagatctcactggcggcgggcgtgttcgcggtatttatcggcgcgataatcggtacg
gtgttgggattgctggcgggatattatgaaggctggtgggatcgttttattatgcgcatt
tgcgatgtgctgttcgccttccccggcattttgctggcgattgccgttgtggcggtgtta
ggcagcggtattgctaatgtgatcgttgcggtggcgattttctctattccggcgtttgct
cgtctggtgcgcggaaataccctggtcttaaaacagcagacgtttattgagtctgcccgc
agtatcggcgccagcgacacgacgattttgtttagccatatattgccgggaacggtctcg
tcaattgtggttttctttacgatgcgtatcggtacgtcaattatttccgcggcaagcctg
tcatttctcggattaggcgcgcagccgccaacgccggagtggggagcgatgctcaatgaa
gcgcgggcggatatggtcatcgcgccgcacgtagcgctcttcccggcggtggcgattttc
ctgactgtgctggcgtttaacctgttaggcgacgggttgcgcgatgcgctggacccgaag
attaaggggtaa

DBGET integrated database retrieval system