KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0954Help
Entry
SeD_A0954         CDS       T00757                                 

Definition
(GenBank) hypothetical protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACH74103
Position
949001..949135
Genome map
AA seq 44 aa AA seqDB search
MVRAGILQISEQKLYRNLIGSGGINRCGYQQKVKKGNSKKILDL
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atggtcagggcagggattctacagatatccgaacaaaaattgtatcgcaatctcatcggg
agcggcggcatcaaccgttgtggttatcagcaaaaggtgaaaaagggcaattctaagaaa
attcttgatctctga

DBGET integrated database retrieval system