KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1228
Entry
SeD_A1228         CDS       T00757                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
KEGG Orthology (KO) [BR:sed00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sed02044]
    SeD_A1228
Secretion system [BR:sed02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeD_A1228
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACH75533
UniProt: A0A6C6ZXK2
Position
complement(1223324..1223740)
AA seq 138 aa
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGI
EEPEGSDNYRSAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDID
DVLEFDMAPDGSQHYRVE
NT seq 417 nt   +upstreamnt  +downstreamnt
gtgataccggcgcgcgaaaagcctgccggatcgctgtttgagcgtctggaaaaccctcct
gccagaaactggcgggagggcagtaatatagaggcgttcaggcagtccattcgccatagt
ctgcgcaatatcctgaacacccgctccggcagttgtcggggaacaccggggctgggtatt
gaagagccggaagggtcggataattaccgcagcgccatgagccaggccatcgtgcagtgt
attgagcgttatgaaccccggatttcgcacgcggaggtccgggcaatcctgccacaggcc
gccagcccacaggagataatttttcgtatcaccgcctgggtgacatttaacgatatcgac
gatgtgctggagtttgatatggcaccggacggtagtcagcattatcgggtggagtag

DBGET integrated database retrieval system