KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2410Help
Entry
SeD_A2410         CDS       T00757                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00340  Histidine metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01230  Biosynthesis of amino acids
Module
sed_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SeD_A2410 (hisD)
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SeD_A2410 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACH77714
Position
2281061..2282365
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNSCSPEQQRALLTRPAISASDSITRTVSDILDNVKTRGDDALREYSAKFDK
TEVTALRVTPEEIAAAGARLSDELKQAMAAAVKNIETFHSAQTLPPVDVETQPGVRCQQV
TRPVSSVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGVQE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQMILLTPDADIARKVAEAVERQLAELPRADTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattgactggaacagctgtagccctgaacagcagcgtgcgctg
ctgacgcgtccggcgatttccgcctctgacagtattacccggacggtcagcgatattctg
gataatgtaaaaacacgcggtgacgatgccctgcgtgaatacagcgctaaatttgataaa
acagaagtgacagcgctacgcgtcacccctgaagagatcgccgccgccggcgcgcgtctg
agcgacgaattaaaacaggcgatggccgctgccgtcaaaaatattgaaacgttccattcc
gcgcagacgctaccgcctgtagatgtggaaacccagccaggcgtacgttgtcagcaggtt
acgcgtcccgtctcgtctgtcggtctgtatattcccggcggctcggctccgctcttctca
acggtgctgatgctggcgacgccggcgcgcattgcgggatgccagaaggtggttctgtgc
tcgccgccgcccatcgctgatgaaatcctctatgcggcgcaactgtgtggcgtgcaggaa
atctttaacgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgagtccgta
ccgaaagtggataaaatttttggccccggcaacgcctttgtaaccgaagccaagcgtcag
gtcagccagcgtctcgacggcgcggctatcgatatgccagccgggccgtctgaagtactg
gtgatcgcagacagcggcgcaacaccggatttcgtcgcttctgacctgctctcccaggct
gagcacggcccggattcccagatgatcctgctgacgcctgatgctgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcggaactgccgcgcgcggacaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaatcatccagacgcgcaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgtcttaccgacctatggctatactgctacctgttccagc
cttgggttagcggatttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacattggcggcggcagaacgtctgaccgcccataaa
aatgccgtgaccctgcgcgtaaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system