KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2701Help
Entry
SeD_A2701         CDS       T00757                                 

Gene name
hisP
Definition
(GenBank) histidine ABC transporter, ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SeD_A2701 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sed02000]
    SeD_A2701 (hisP)
Enzymes [BR:sed01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     SeD_A2701 (hisP)
Transporters [BR:sed02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    SeD_A2701 (hisP)
   Histidine transporter
    SeD_A2701 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_13 AAA_16 AAA_23 G-alpha PRK AAA_33 cobW RsgA_GTPase AAA_24 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: ACH74666
Structure
PDB: 

Position
complement(2583294..2584070)
Genome map
AA seq 258 aa AA seqDB search
MMSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSE
GAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQ
VLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEP
TSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQV
FGNPQSPRLQQFLKGSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagaaaataaattacacgttatcgatttgcacaaacgctacggcggtcatgaa
gtgctgaaaggggtatcgctgcaggcccgcgccggagatgtgattagcatcatcggctcg
tccggctccggtaaaagcacttttttgcgctgtattaacttcctcgaaaaaccgagcgaa
ggcgcgattattgtgaacggtcagaacattaatctggtgcgcgacaaagacgggcagctc
aaagtggcggataaaaatcagctacgcttgttgcgtacccgcctgacgatggtgtttcag
cactttaacctctggagccacatgacggtgctggaaaatgtgatggaagcgccgattcag
gtactgggattaagcaagcacgacgcgcgcgagcgggcgttgaaatatctggcgaaggtg
gggattgatgagcgcgctcagggcaaatatcccgtccatctctccggcggccaacagcag
cgcgtttctattgcgcgcgcgctggcgatggaacctgacgttttactgttcgatgaaccc
acatcggcactcgatcctgaactggtcggcgaagtgttgcgcatcatgcaacaactggcg
gaagaaggcaaaacgatggtggtggtcacgcatgaaatgggcttcgctcgccatgtctct
tcgcacgttatttttctgcatcaggggaaaattgaagaagagggtgatccggagcaggtg
ttcggcaatccgcaaagcccgcgtttacagcaattcctgaaaggctcgctgaaataa

DBGET integrated database retrieval system