KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A3352Help
Entry
SeD_A3352         CDS       T00757                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00071  Fatty acid degradation
sed00280  Valine, leucine and isoleucine degradation
sed00310  Lysine degradation
sed00362  Benzoate degradation
sed00380  Tryptophan metabolism
sed00620  Pyruvate metabolism
sed00630  Glyoxylate and dicarboxylate metabolism
sed00640  Propanoate metabolism
sed00650  Butanoate metabolism
sed00900  Terpenoid backbone biosynthesis
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
sed01212  Fatty acid metabolism
sed02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeD_A3352
   00630 Glyoxylate and dicarboxylate metabolism
    SeD_A3352
   00640 Propanoate metabolism
    SeD_A3352
   00650 Butanoate metabolism
    SeD_A3352
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SeD_A3352
   00072 Synthesis and degradation of ketone bodies
    SeD_A3352
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeD_A3352
   00310 Lysine degradation
    SeD_A3352
   00380 Tryptophan metabolism
    SeD_A3352
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeD_A3352
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SeD_A3352
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SeD_A3352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sed04147]
    SeD_A3352
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SeD_A3352
Exosome [BR:sed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SeD_A3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACH73594
Position
complement(3227405..3228613)
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDE
VILGQVLTAGAGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAYALSSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLAL
LHPAFDSLGSVTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgatagtgggggcttta
cggacccccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agtatggtcgtaaaagcgttaattgagcgcaccggcgtggacgctaatgctatcgatgag
gtcatcctcggtcaggtactgacggctggcgccgggcagaatccggcgcgccagtcagcc
atcaaaggagggctgccgactaccgtttccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcgttgcacctggcgacgcaggctattcagtgcggcgaagcggacattgtt
attgcgggcgggcaggagaatatgagccgtgcgccgcatgtcctcaatgacagccgtacc
ggcgcgttgcctgatgccgacaatctggtggatagtctggtacatgatggcttatgggat
gccttcaacgattatcacattggcgtgacggcagaaaacctggcgcgggaatatggcatc
agccgcgagttacaggatgcttatgcgctcagttcgcagcaaaaagccagggccgcgatt
gataccggacgttttaaagatgagattgtccccatcgtcacgcaacgtaatgggcagacc
gcaattgtcgatacggatgaacaaccgcgggccgacgccagtgcggaggggttagccctg
ctgcatccggcgtttgatagtttaggttcggtgacggcgggtaatgcctcctcaatcaac
gatggcgccgccgcggtgatgatgatgagcgaggcgaaagcccaggcgctggggctgccg
gtgctggcgcgcatccgcgcgtttgccagcgtcggcgtcgatcctgcgctaatggggatt
gcgccggtatatgctacccggcgctgtctggagcgtgccggctggcaactgacggaggtc
gaccttatcgaagccaacgaagcgtttgccgcccaggcgttgtcggtaggaaaaatgctg
gaatgggatgagcgacgggtaaacgttaatggcggcgcgattgcgctggggcatcccatt
ggcgcttccggttgtcgaattctggtttcactggtgcacgaaatggttaaacgcgacgcg
cgaaaaggtctggcgacgctgtgtatcggtggcggccagggcgttgctttaaccattgaa
cgcgattga

DBGET integrated database retrieval system