KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4592Help
Entry
SeD_A4592         CDS       T00757                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00620  Pyruvate metabolism
sed00630  Glyoxylate and dicarboxylate metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01200  Carbon metabolism
Module
sed_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeD_A4592 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SeD_A4592 (aceB)
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SeD_A4592 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACH74054
Position
4432084..4433688
Genome map
AA seq 534 aa AA seqDB search
MMNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDID
NGKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFE
DSLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTW
RGEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLP
RGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQ
VVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANN
GHDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMR
ANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALF
REMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgag
ctggaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgt
tttacgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgat
aacggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcag
attcgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaa
cgtaaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaa
gactcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcg
gtgaacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgat
ccggccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctgg
cggggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactat
aaagcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctgg
caggaggcagcctggtggagcgaagtcttcagctacgccgaagaccgctttaacctgccg
cgcggtacgatcaaagcgaccctgttgattgaaacgcttcctgctgttttccagatggat
gagattcttcatgcgttgcgtgatcatattgtcggtctcaactgtggtcgctgggattat
attttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacaggcag
gtggtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgt
cacaagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgtt
gaacgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaac
ggccacgacggcacgtggattgcgcatcctgggttggcggataccgcaatggccgtcttt
aacgaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccg
attaccgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgc
gccaatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgta
ccgatttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctgg
cagtggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttc
cgcgaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctac
agcagcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgac
ttaatcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system