KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4745Help
Entry
SeD_A4745         CDS       T00757                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00564  Glycerophospholipid metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
Module
sed_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SeD_A4745 (psd)
Enzymes [BR:sed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SeD_A4745 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: ACH75039
UniProt: B5FRL8
Position
complement(4605091..4606059)
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMTEAQKPDTASY
RTFNDFFVRPLRDDVRPLNTDPNILVMPADGVISQLGRIEEDKILQAKGHNYSLEALLAG
NYLMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPEGEHEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVNLIASLASLSVTKIGQPLATSTETFVAPEVEPAPL
PAEEIKAEHDASPLVDNKKDDT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaaactttcgctacaatacattctgccgaaactatggctcactcgc
ctggcgggctggggcgcaagcaaacgagcaggatggctgacaaaactggttatcgatctc
ttcgtaaagtattacaaagtcgatatgaccgaggcgcaaaaaccggataccgccagctat
cgtacgttcaatgatttctttgttcgtccgctgcgtgatgacgtgcgtccgctcaatacc
gatcctaacatcctggttatgcctgccgacggcgtgataagccagttgggtcgtatcgaa
gaagataaaattttgcaggccaaaggccataattacagccttgaagcgttgctggcgggt
aactacctgatggcggataagttccgcaacggcacgtttgtgaccacttacctctcccct
cgcgactaccatcgcgtgcatatgccatgcaacggcatcctgcgcgaaatgatctacgta
ccgggcgatctgttctccgttaaccatctgaccgcgcaaaacgtccccaacctgtttgcc
cgcaacgagcgcgttatctgtctgtttgataccgagttcggccctatggcgcagattctg
gtcggcgcaactattgtcggcagtatcgaaaccgtctgggcggggaccattaccccgccg
cgcgaaggcatcatcaagcgctggacctggccagaaggcgaacatgaagggtctgtcgcc
ttgttgaaaggccaggagatggggcgctttaaactgggttccacggttatcaacttattt
gcgccggggaaagtgaatctgatcgcgtcgctggcaagcctgtccgttaccaaaattggc
caaccgctggcgacgtcgaccgaaacattcgtcgcgccggaggtagaacctgctccgctg
ccggcagaagaaattaaagccgaacacgacgccagcccgctggttgacaataaaaaagac
gacacctaa

DBGET integrated database retrieval system