KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4793Help
Entry
SeD_A4793         CDS       T00757                                 

Definition
(GenBank) fkbp-type 22 kda peptidyl-prolyl cis-trans isomerase
  KO
K03773  FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC:5.2.1.8]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
KEGG Orthology (KO) [BR:sed00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sed03110]
    SeD_A4793
Enzymes [BR:sed01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SeD_A4793
Chaperones and folding catalysts [BR:sed03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    SeD_A4793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C FKBP_N
Motif
Other DBs
NCBI-ProteinID: ACH76156
Position
4646438..4647100
Genome map
AA seq 220 aa AA seqDB search
MLPATFLISDEEKIMATPTFDTIEAQASYGIGLQVGQQLSESGLEGLLPEALVAGIADAL
EGKHPAVPVDVVHRALREIHERADAVRRERFKAMAAEGVKYLEENREKDGVNSTESGLQF
RVLTQGEGAIPARTDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIAGWIEALTLMP
VGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELLEIL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgctacttttttgatatccgatgaagaaaaaataatggccaccccgactttt
gacactattgaagcgcaagcgagctacggcattggtttgcaggtagggcagcagctcagc
gaatccggtcttgaagggctgttgcctgaagcgctggttgcaggcattgctgatgcgctg
gaaggtaaacacccggcggttcctgttgatgtggtgcatcgtgcgctgcgtgaaattcat
gagcgtgcggacgcggtgcgtcgtgagcgtttcaaagcgatggcggccgaaggcgtgaaa
tacctggaagaaaaccgcgaaaaagacggtgtgaacagtactgaatctggtttacagttc
cgcgttctgacgcagggcgaaggcgcgattccggcgcgtaccgaccgcgtacgcgtgcat
tacaccggtaagcttattgatggcaccgtatttgacagctccgtcgcgcgcggcgaaccg
gctgaattcccggtaaatggcgtgatcgccggctggattgaagctctgactctgatgccg
gtaggttccaaatgggaactgactatcccacaggagctggcctatggcgagcgtggggcc
ggggcctctattccgccattcagcaccctggtgtttgaggtggaactgctggaaattctg
taa

DBGET integrated database retrieval system