KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_B0102Help
Entry
SeD_B0102         CDS       T00757                                 

Definition
(GenBank) pilx4 protein
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeD_B0102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sed02044]
    SeD_B0102
Enzymes [BR:sed01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SeD_B0102
Secretion system [BR:sed02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SeD_B0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagE_TrbE_VirB VirB3
Motif
Other DBs
NCBI-ProteinID: ACH73562
Position
pCT02021853_74:complement(60342..62972)
Genome map
AA seq 876 aa AA seqDB search
MYALILPGWYAIRRVTQFDERFFDLLYLRTLVKGHPLSNKRFSAVHYAGSQYDEVDISKV
DNFMKLKDQSSVEELIPYSSHITDNIIVTKNRDLLATWQIDGAYFECVDSEDLSILTDQL
NTLIRSFEGKSVTLYPHRIRCKKDVRPVFNSKIPFVNRVMNDYYESFPQSEFFENKLFLT
ICFKPFTTEDKVTHFFSRSKKQKDIFKEPVNEMNEICDRLNTYLSRFHSRRLGLYEDHGV
VYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGNDAGQITASDHARYFRCIEIK
DYFQETDAGILDALMYLPVEYVVTSSFTAMDKQSAIKALDDQIDKLEMTDDAAKSLLADL
KVGLDMVSSGYISFGKSHQTLVVFADSPERLVKDTNIVTSTLEDLGLIVTYSTLSLGAAY
FAQLPGNYTLRPRLSTLSSLNFAEMESFHNFFSGKEKGNTWGEKLITLRGSGNDIYHLNY
HMTTEHQNFFGKNPTLGNTEILGTSNVGKTVLLMTKAFAAQQFGTPESFPANRKLKKLTT
VFFDKDRAGEVGIRAMGGSYYRVKEGEPTGWNPAALPPTKRNIAFMKDLVRLLCTLNSEP
LDDYQNSLISDAVERLMQRSDRSYPISKLRPLIQEPDDTETKRHGLKARLKPWTQGEEFG
WVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASAASFYLIYRVTMLADGRRLLIYMDEFW
QWINNEAFRDFVYNKLKTGRKLDMVLVVATQSPDELIKSPIAAAVREQCATHIYLANPKA
KRSEYVDGLQVRELYFDKIKAIDPLSRQFLVVKNPQRKGESDDFAAFARLELGKAAYYLP
VLSASKPQLELFDEIWKEGMKPEEWLDTYLEQANLI
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcccttattcttcctggctggtatgccatcaggcgtgtaacacagtttgatgaa
cgcttttttgaccttctgtatctgagaactcttgtcaaagggcatcctttatcaaacaag
cgattcagcgcagtccattatgcggggagccagtacgacgaagttgatatttcaaaagtg
gataactttatgaagctgaaagaccagtcttctgttgaagagttaattccgtactcttca
catatcactgataatattatcgttacaaaaaaccgggatttgctggcaacctggcagata
gacggtgcttactttgagtgtgttgattctgaagatttgtcaattctgacagatcagctt
aatacgcttatacgtagctttgaagggaaatctgttacgctttatcctcatcgtatcagg
tgtaaaaaggacgtcagaccagtatttaacagtaaaattccttttgtgaacagagtaatg
aatgattattacgagtcattccctcagtctgaatttttcgagaataaattatttctgacg
atttgttttaaaccttttactacggaagataaagtaacacatttcttttcacgcagtaaa
aaacaaaaagatatctttaaagagcctgttaatgaaatgaatgaaatttgcgacaggttg
aatacctatctgtcccgttttcattcccgacgtcttgggctttatgaagatcatggggtt
gtttattcagatcagttatctctgttccagtatctactttctggtcgatggcaaaaggtc
agggttagcagtagtccgttttatacatatctgggaggaaaagacctgttctttggtaat
gatgccggacaaattaccgcgtcagaccatgcccggtattttcgttgcatagagattaag
gattattttcaggagacggatgccggtattctggatgctctgatgtatctccccgttgag
tatgtcgtgacatcgtcctttactgcgatggataagcagtcagcgattaaggcgctggat
gatcagatcgataagctggaaatgacagatgatgctgccaaatctttgctggcagatctg
aaagtcggactggatatggtttccagtggatatatttctttcgggaaatcgcatcagacc
ctggttgtctttgcggattcaccggagcgtctggtgaaagacaccaatatcgtgacttcc
actctggaagatttggggctgattgtcacttattcaacactgagtcttggcgcagcttat
tttgctcagctaccaggaaattatacgcttcgccctcgtctgagtaccctcagtagtctt
aattttgccgaaatggaaagttttcataatttcttttcaggaaaagaaaaaggaaatacc
tggggggaaaaactgattactcttcgggggtcaggtaatgatatctaccatctgaattac
catatgacgactgaacatcagaatttcttcggtaagaacccgacgctggggaataccgaa
attctcggtacgtctaacgtgggtaaaaccgtattactgatgacaaaagcatttgccgcc
cagcagttcggtacgccggaatcattccctgcaaacagaaaactgaaaaaactgaccacg
gtttttttcgataaagaccgggcaggtgaagtcggtatacgggcaatggggggatcttat
taccgggtgaaggagggagagccgacaggctggaatcccgccgcactgccgccaacaaaa
cgtaatatcgcttttatgaaggacctggtgaggctgctttgtactctcaacagtgagccg
ctcgatgattaccagaacagcctgatttcagatgcggttgaacgtcttatgcaacggtca
gatcgctcttatcctatcagtaaactacggcctcttatccaggagccggatgatactgaa
accaaacgtcatggacttaaagcccgtcttaagccgtggacgcagggggaagagtttggc
tgggtgttcgacaatcgggaagacacgtttgatgtcgataacctggatgttttcggtatt
gatggaacggagttcctggataataaggtgctggccagtgctgcttcattctatctcatc
tatcgggtcaccatgttggccgatggtcgcaggcttcttatctacatggatgagttctgg
caatggatcaataacgaagcgttcagggactttgtttacaacaagctgaaaaccggacgt
aaactcgatatggtgcttgtcgtagccacacagtcaccggatgaactgattaaatcaccc
attgcggcagcggttcgtgagcaatgcgccactcatatctatctggcaaacccgaaagcc
aaacgtagtgaatatgttgatggtttgcaggtcagggagctttattttgacaaaattaaa
gctattgatccgctgtcccgccagttcctggttgttaagaacccacagaggaaaggtgaa
agtgatgattttgctgcttttgccagactggagctgggaaaagcagcgtattacttaccg
gttctcagtgcatcaaaaccccagttagaactgttcgatgaaatctggaaagaaggaatg
aagccggaagagtggcttgatacctatctggaacaggcgaaccttatttga

DBGET integrated database retrieval system