KEGG   Sedimentitalea sp. W43: EBB79_04220Help
Entry
EBB79_04220       CDS       T05780                                 

Gene name
ruvC
Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
sedi  Sedimentitalea sp. W43
Pathway
sedi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sedi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EBB79_04220 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sedi03400]
    EBB79_04220 (ruvC)
Enzymes [BR:sedi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     EBB79_04220 (ruvC)
DNA repair and recombination proteins [BR:sedi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EBB79_04220 (ruvC)
    RecFOR pathway proteins
     EBB79_04220 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: AZV80300
UniProt: A0A3T0N8E6
Position
854521..855018
Genome map
AA seq 165 aa AA seqDB search
MRILGIDPGLRNLGWGVIESHGSKLSHVANGVCHSDGDDLGERLLSLHNQVTEVIEAHAP
DQAAIEQTFVNKDGAGTLKLGQARGVALLTLAKAGLAVGEYAPNRVKKTVVGVGHADKTQ
VMHMVKLQLPGCNPENADAADALAIAICHAFYRGTADRQLREVRV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcggattttggggattgatccggggttgcggaaccttggttggggtgtgatcgaatca
catggttcaaaactgagccacgttgccaacggagtttgccactcggatggggacgatctt
ggcgaacggctgctgtccctgcacaaccaggtcaccgaagtgatcgaagcccacgcacca
gatcaggcggcgattgagcagacctttgtgaataaggatggcgccgggacgttgaaactg
gggcaggcgcgcggagtggccctgctgactttggccaaggccggattggcagtgggagag
tatgcgccgaaccgggtcaagaaaacggttgttggggttggccatgctgacaagacacag
gtgatgcatatggtgaagctgcaattgcccggctgtaacccagaaaacgcggatgcggcg
gatgctttggcgattgcaatctgccatgcgttctatcgcggcacagcggaccggcaactg
cgcgaggtgcgggtatga

DBGET integrated database retrieval system