KEGG   Sedimentitalea sp. W43: EBB79_05520Help
Entry
EBB79_05520       CDS       T05780                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sedi  Sedimentitalea sp. W43
Pathway
sedi00450  Selenocompound metabolism
sedi00970  Aminoacyl-tRNA biosynthesis
sedi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sedi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EBB79_05520
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EBB79_05520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sedi01007]
    EBB79_05520
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sedi03016]
    EBB79_05520
Enzymes [BR:sedi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EBB79_05520
Amino acid related enzymes [BR:sedi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EBB79_05520
Transfer RNA biogenesis [BR:sedi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EBB79_05520
 Prokaryotic type
   Other AARSs
    EBB79_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 ProSAAS
Motif
Other DBs
NCBI-ProteinID: AZV77403
UniProt: A0A3T0N045
Position
complement(1122864..1124582)
Genome map
AA seq 572 aa AA seqDB search
MARILITSAIPYINGIKHLGNLVGSQLPADLYARYHRGRGNEVMFLCATDEHGTPAELAA
AKADKPVDEFCAEMHQVQAGIAKGFGLSFDHFGRSSSPQNHKLTQHFAGKLAENGLIREV
VEKQVYSNADGRFLPDRYIEGTCPNCGYDKARGDQCEECTKQLDPTDLIDPRSAVSGSID
LEVRETKHLYLCQSTLKDQLDDWINSKHDWPVLTTSIAKKWLHDGDGLRDRGITRDLDWG
ISVKKGDQDWPGMDGKVFYVWFDAPIEYIACAGEWAEANGKADTDWQRWWRTDKGADDVK
YVQFMGKDNVPFHTLSFPATILGSGEPWKLVDHLKSFNYLNYDGGQFSTSQGRGVFMDQA
LEILPADYWRWWLLSHAPESSDSEFTWENFQQSTNKDLADVLGNFVSRITKFCRAKFGEV
VPEGGAYGEQELALIAELTTRIRAYETQMEAIEVRKSAQELRAIWVAGNEYLQSAAPWST
FKTDPEKAATQVRMGLNLIRLYAVLSAPFIPTAAASMLSAMNTLDTRWPDDVAAALDALP
AGHDFAVPEVLFAKITDDQVEDWRQRFSGVRD
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaattctcattacctcggcgatcccttatatcaacgggatcaaacatctgggc
aatctggtgggcagtcagctgccagccgatttatatgcccgctaccatcgtggccgtggc
aatgaagtgatgtttctctgcgccaccgacgaacacggcaccccggccgagctggctgcc
gccaaggcagacaaaccagtcgatgaattctgcgccgagatgcaccaggttcaggccggt
atcgccaaggggtttggccttagctttgaccattttggccgctcaagcagcccgcagaac
cacaagctgacccagcatttcgcaggcaaactggccgaaaacggcctgatccgcgaagtg
gtcgaaaagcaggtctactctaacgccgatggccgttttctgccggaccgctatatcgag
ggcacctgccccaactgcggctacgacaaggcgcgcggcgaccaatgcgaggaatgcacc
aagcagctggaccccaccgacctgatcgacccacgctctgccgtgtcgggatcgatcgac
cttgaggtgcgcgagaccaaacatctgtacctgtgccaatccaccctgaaggaccagctg
gacgattggatcaattcgaaacatgactggccagtgctgaccacctcgattgccaagaaa
tggctgcatgacggtgacgggctgcgtgaccggggcatcacccgcgatctggactggggc
atttcggtcaaaaaaggtgatcaggactggcccggcatggacggcaaggtgttctatgtt
tggtttgatgcccctatcgaatacatcgcctgcgcaggcgagtgggccgaggccaatggc
aaggctgacaccgactggcagcgctggtggcgcaccgacaagggcgcggacgacgtcaaa
tatgtgcagttcatgggcaaggacaacgtgcccttccacaccctgtcctttccggcgacc
attctgggctcgggcgagccatggaaacttgtggaccacctgaaatcgttcaactacctg
aattatgacggcggccagttctcgacctcgcaggggcgcggcgtcttcatggatcaggca
ctggagatcctgccggccgactactggcgctggtggttgctgtcacacgcccccgaaagc
tcggattcggaattcacctgggaaaatttccagcaatcgacaaacaaggatctggccgac
gtactgggcaactttgtcagccgcatcaccaaattctgccgcgccaagtttggcgaagtg
gtgcccgagggcggcgcatatggtgaacaagaactggcgctgatcgctgaactgaccacc
cgcatccgcgcttatgagacccagatggaggccatcgaggtccgcaaatcggcgcaggag
ctgcgcgcgatctgggtggccggcaacgaatatctacaaagcgccgcaccctggtcgacc
ttcaaaaccgacccggagaaagccgcgacgcaggtccgcatgggtctgaacctgatccgc
ctttatgcagtgctgagtgcccccttcattcccaccgctgccgccagtatgctgagtgcg
atgaacacgctggacacccgctggccggacgatgtagccgccgcgctggacgcgctgccc
gctggccacgattttgcagtgcccgaggttctgtttgccaaaatcaccgacgatcaggtc
gaggactggcgacagcggttctctggggttcgcgactaa

DBGET integrated database retrieval system