KEGG   Sedimentitalea sp. W43: EBB79_15450Help
Entry
EBB79_15450       CDS       T05780                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sedi  Sedimentitalea sp. W43
Pathway
sedi00230  Purine metabolism
sedi00250  Alanine, aspartate and glutamate metabolism
sedi01100  Metabolic pathways
Module
sedi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sedi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EBB79_15450
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EBB79_15450
Enzymes [BR:sedi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     EBB79_15450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AZV79132
UniProt: A0A3T0N570
Position
complement(3156741..3158036)
Genome map
AA seq 431 aa AA seqDB search
MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGEVFKLAALPSGIV
RGGKLSVIGNGVVLDPWHLLNEIAGIQKQGVTVSPETLMIAENTPLILPIHGELDRAREE
AASKGTKIGTTGRGIGPAYEDKVGRRSIRVADLADEATLEARVDRALQHHDPLRKGLGIE
AVDRDALIAQLKEIAPEILKYAAPVWKVLNDKRKAGKRILFEGAQGALLDIDFGTYPFVT
SSNVIAGQAATGTGMGPGAIDFVLGIVKAYTTRVGEGPFPAELNDADGQRLGERGHEFGT
NTGRQRRCGWFDAVLVRQTCATSGVNGIAFTKLDVLDGFETLKICTGYELDGKALDYLPT
AADQQSRCTPVYEEMPGWSESTEGARSWADLPANAIKYVRRVEELIGCPVAMLSTSPERE
DTILVTDPFED
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtcgtcgtagtcggcgcccaatggggtgacgagggaaaaggcaagatcgta
gactggctcagcgagcgcgccgatgttatcgcgcgcttccagggtggtcataacgcgggc
catacactggtcatcgacggcgaggtcttcaaactcgcggccctgccgtctggcattgtc
cgtggcggcaagctgagcgtgatcggcaatggcgtggtgctggacccctggcacctgctg
aacgagatcgcgggcatccagaagcagggcgtaaccgtcagccctgaaaccctgatgatc
gctgaaaacacgccgctgatcctgcccattcacggcgaacttgaccgcgcccgcgaagaa
gctgccagcaagggcaccaagatcggcaccaccggccgcggcatcggcccggcctatgag
gacaaggtcggccgccgctcgatccgggtcgctgatctggcagatgaggccacactcgaa
gcccgcgtcgatcgtgccctgcagcatcacgaccccttgcgcaaaggtctgggaatcgaa
gccgtcgaccgcgatgcgttgattgcacagctcaaagagatcgcacccgaaatcctgaaa
tatgccgctccggtctggaaagtgctgaacgacaagcgcaaggccggtaaacggatcctg
tttgaaggcgcccagggcgcgttgctggatatcgattttggcacctatccctttgtgacc
tcatcgaacgtcattgccggtcaggctgcgacgggcaccggcatgggaccaggcgccatc
gattttgtactgggcatcgtcaaagcctataccacccgagtcggcgagggcccgttccct
gccgagttgaacgacgccgatggccaacgtctgggcgagcgcggccatgagtttggcacc
aataccggacgtcagcggcgctgtggctggttcgacgcggttctggtgcgccagacctgt
gccaccagcggcgtcaatggcatcgcctttaccaagctcgacgtgttggacggctttgaa
actctgaagatctgcaccggttacgagctggacggcaaggcgctggactatctgccgacg
gctgcggaccaacagtcccgttgcaccccggtctatgaagaaatgccgggctggagcgaa
agcaccgaaggcgcgcgcagctgggcggatctgccggccaatgcaatcaaatacgtccgc
cgcgtcgaagagttgatcggctgtccggttgcgatgctgtccaccagcccggagcgggag
gataccattctggtcaccgacccgtttgaagactga

DBGET integrated database retrieval system