KEGG   Sedimentitalea sp. W43: EBB79_16240Help
Entry
EBB79_16240       CDS       T05780                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sedi  Sedimentitalea sp. W43
Pathway
sedi00260  Glycine, serine and threonine metabolism
sedi01100  Metabolic pathways
sedi01110  Biosynthesis of secondary metabolites
sedi01120  Microbial metabolism in diverse environments
sedi01130  Biosynthesis of antibiotics
sedi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sedi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBB79_16240
Enzymes [BR:sedi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EBB79_16240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AZV79277
UniProt: A0A3T0N5J8
Position
3315294..3316328
Genome map
AA seq 344 aa AA seqDB search
MFFASDNSGPVHPQVLQALTQANSGYAMGYGADAQMDALRDTVRTVFEAPEAAVFLVATG
TAANALALATLSQPYQTVFCSDVAHIHEDECNAPEFYSGGAKLTLVPCGDKMSPQALCLA
IEGEETRGVHGPQRGPVAISQVTERGSVYSLEELRALTAVAGEFDLPVHLDGARFANAMV
ALGCTPAEMSWKAGIDAVSFGGTKNGCMGVEAVIFFDPKHAWEFELRRKRGAHLFSKNRF
LAAQMLAYLQDDLWLDNARKANANSAYLGEGLHQAGAEFLHKPQANMIFASLPRASHQRA
FDAGASYHLWDGPLAGQGDEMVGARFVCDWSISTAQIDEFLALI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttttttgcctctgacaattctggccccgttcacccgcaggttttgcaggcgttgacg
caggcaaactctggctacgcaatgggctatggtgccgatgcccaaatggatgcattgcgt
gatacagttcgcactgtatttgaggcccccgaggcggcggtctttctggttgccaccggc
accgcagccaatgcgctggcgctggcgaccctgagccagccctatcagaccgtgttctgt
tcggatgtagcccatatccatgaggatgagtgcaacgcgcccgaattttattcgggaggg
gccaaactgacgctggtgccttgcggtgacaagatgtctccgcaggccctgtgcctggcg
attgaaggcgaagaaacccgaggcgtgcatggaccacaacgcggcccagtggcaatcagt
caggtcactgaacgcggctcggtctattcgttggaagaattgcgggcgttaacagccgtt
gcaggtgaatttgacctgccggtgcacctggatggcgcgcgttttgccaatgccatggta
gcgctgggttgcactccggctgaaatgagttggaaggcgggcattgatgcggtcagcttt
ggcggcaccaagaacggctgcatgggcgtcgaggcagtaatcttttttgatccaaaacat
gcctgggaatttgagctgcgccgcaaacgcggggcgcatctgttttccaaaaaccgtttt
ttggctgcacagatgctggcctatttgcaggacgatttgtggctggacaacgcccgtaag
gccaatgccaacagtgcctatttaggtgaaggtttgcaccaggccggagccgaatttctg
cacaagcctcaggccaacatgatttttgcctccctgccccgcgccagtcaccagcgcgcc
tttgatgcgggtgcgtcttatcacctgtgggatgggccgttggcgggtcaaggtgatgaa
atggttggcgcacgtttcgtttgtgactggtcgatcagtacagctcagattgacgaattt
ctggcgttgatttga

DBGET integrated database retrieval system