KEGG   Sedimenticola thiotaurini: AAY24_02530Help
Entry
AAY24_02530       CDS       T03943                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00071  Fatty acid degradation
seds00072  Synthesis and degradation of ketone bodies
seds00280  Valine, leucine and isoleucine degradation
seds00310  Lysine degradation
seds00362  Benzoate degradation
seds00380  Tryptophan metabolism
seds00620  Pyruvate metabolism
seds00630  Glyoxylate and dicarboxylate metabolism
seds00640  Propanoate metabolism
seds00650  Butanoate metabolism
seds00900  Terpenoid backbone biosynthesis
seds01100  Metabolic pathways
seds01110  Biosynthesis of secondary metabolites
seds01120  Microbial metabolism in diverse environments
seds01130  Biosynthesis of antibiotics
seds01200  Carbon metabolism
seds01212  Fatty acid metabolism
seds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAY24_02530
   00630 Glyoxylate and dicarboxylate metabolism
    AAY24_02530
   00640 Propanoate metabolism
    AAY24_02530
   00650 Butanoate metabolism
    AAY24_02530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAY24_02530
   00072 Synthesis and degradation of ketone bodies
    AAY24_02530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAY24_02530
   00310 Lysine degradation
    AAY24_02530
   00380 Tryptophan metabolism
    AAY24_02530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAY24_02530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAY24_02530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAY24_02530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seds04147]
    AAY24_02530
Enzymes [BR:seds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAY24_02530
Exosome [BR:seds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAY24_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKH19407
UniProt: A0A0F7JUW7
Position
580144..581328
Genome map
AA seq 394 aa AA seqDB search
MSDPIVIVDIARTPMGGFQGVLSSLTAPQLGAAAIAAAVSRAGISSEDVQEVLMGNVLTA
GIGQAPTRQAAIGAGIPLNVPCAGISKVCGSGMKAVMLAHDLIKAGTNEVMVAGGMESMT
NAPYLLEKARGGYRLGHGKTMDHMFLDGLEDAYFDRGALMGTFAEQCADHFNFTREQQDE
FAIASLSRANAAIEAGRFEREIVPVTVSSRKGDTEVATDEQPGNARPEKIPSLRPAFRKD
GTVTPANSSSISDGAAALVLMRASEAERRGLSPKAVIRGHAGYAGEPRWFTTAPVYAMQN
LLQRLEWKTDDVDLWEINEAFAVVTMAAMREMELDHEKVNVNGGACALGHPIGASGARII
VTLLAALEEKGLKRGVASLCIGGGEATAVAIERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatccaattgtcattgtcgatattgcccgcaccccgatggggggttttcagggc
gtcctctcttcactgaccgcgccccagctcggcgccgcggccattgccgccgccgtgtca
cgggccggtatcagcagtgaggatgtacaggaggtactgatgggtaatgtgctgaccgcc
ggaatcggccaggcgcccacccgccaggcggcgatcggcgccggcattccactgaacgta
ccctgcgccggcatcagtaaggtgtgtggctccggcatgaaggcggtgatgctggcccac
gacctgatcaaggccggcaccaacgaggtcatggtggcaggtggtatggagtccatgacc
aacgccccctacctgctggagaaggcccgtggcggttaccgtctgggtcacggcaagacc
atggatcacatgttcctggatgggctggaagacgcctactttgatcggggcgcattgatg
gggacttttgccgagcagtgtgccgatcattttaattttacccgtgaacagcaggatgaa
tttgccatcgcctccctcagtcgcgccaatgcggcaatcgaagcaggccgcttcgagcgg
gagattgtgccggtgaccgtttccagccgtaaaggtgataccgaggtggcgactgacgaa
caacccggtaatgcccgtccggagaagatccctagcctgcgtcctgctttccgcaaagat
ggcacggtgaccccggccaactccagttctatctccgatggtgcggcagccctggtgctg
atgcgcgcttcagaagcggagcgtcgcggtctctcgcccaaggcggtgattcgcggacat
gccggctatgccggcgaaccccgttggttcaccaccgccccggtctacgccatgcagaat
ctgttgcagcgcctggagtggaaaaccgatgacgtggatctgtgggagatcaacgaggcc
tttgccgtagtgaccatggcagccatgcgcgaaatggagctggatcatgagaaggtcaac
gtgaacggtggcgcctgcgcgctgggtcatccgattggtgcctcgggtgcgcgtatcatc
gtcaccctgttggccgcactggaagagaaggggctgaaacggggtgtcgcttcgctctgc
atcggcggcggtgaggcgacggcggtggcgatcgagcgggtttaa

DBGET integrated database retrieval system