KEGG   Sedimenticola thiotaurini: AAY24_09500Help
Entry
AAY24_09500       CDS       T03943                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00220  Arginine biosynthesis
seds01100  Metabolic pathways
seds01110  Biosynthesis of secondary metabolites
seds01130  Biosynthesis of antibiotics
seds01230  Biosynthesis of amino acids
Module
seds_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AAY24_09500
Enzymes [BR:seds01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AAY24_09500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AKH20550
UniProt: A0A0F7K033
Position
2093059..2093982
Genome map
AA seq 307 aa AA seqDB search
MTLPANKPVRHFLSLLDLSPDELRALIHRATELKRILRAGELYEPLKNQTLGMIFEKSST
RTRISFEAGVTQLGGHALFLSSRDTQLGRGEPIEDSARVISRMVDCVMIRTFEHEKVELF
AAHSRVPVINALTDLLHPCQLLADMQTYFEHRGDIAGKTVTWVGDGNNMCHSYINAARQF
DFQLNISCPEGHDPDPSILQGAGDRCRIIREPMEAATDADLVVTDVWASMGQEEEQRQRE
ITFANYQVNEQLMAQARPDALFMHCLPAHRGEEVTAGVIDHPDSVVWDEAENRMHAQKAL
LEMLLRP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacacttccagccaacaaacccgtcagacacttcctgtcacttctggatctttcgccc
gacgagctgcgtgccctgattcaccgggccactgaactgaagcggatactgcgggcgggc
gagttgtacgagccgctgaagaaccagaccctggggatgattttcgagaaatcctcgacc
cggacccggatctccttcgaggcgggtgtcacccagctcggaggacatgcgctgtttctc
tcctcccgggatacccagttgggacgcggcgagccgatcgaggacagcgcccgggtcatc
tcccggatggtggactgcgtcatgatccgtactttcgaacacgagaaggtggagctgttt
gccgcccactcccgggtgccggtgatcaacgccctgaccgacctgctgcacccctgccag
ctactggctgacatgcagacctattttgaacatcgtggcgatattgccggcaagacggtt
acctgggtcggtgatgggaacaacatgtgccactcctatatcaatgccgcccgccagttc
gatttccagctgaatatcagctgcccggaggggcatgacccggatccttcgatcctgcag
ggagccggtgatcgctgccggatcatccgcgagcctatggaagccgccaccgatgccgac
ctggtggtcaccgatgtatgggccagcatggggcaggaagaggagcagcggcaacgggaa
atcacctttgccaactaccaggtgaacgagcagttgatggcgcaggcccggcccgacgcc
ctgttcatgcactgcctgccggcacaccggggcgaagaggtgaccgccggagtgatcgat
caccccgacagcgtggtctgggatgaggcggaaaaccgcatgcacgcccagaaagccctg
ctggagatgctgctgcgcccctga

DBGET integrated database retrieval system