KEGG   Sedimenticola thiotaurini: AAY24_11375Help
Entry
AAY24_11375       CDS       T03943                                 

Definition
(GenBank) serine acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00520  Amino sugar and nucleotide sugar metabolism
seds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AAY24_11375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:seds01005]
    AAY24_11375
Enzymes [BR:seds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     AAY24_11375
Lipopolysaccharide biosynthesis proteins [BR:seds01005]
 Unusual sugar
  AAY24_11375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954 BacteriocIIc_cy
Motif
Other DBs
NCBI-ProteinID: AKH20850
UniProt: A0A0F7K105
Position
complement(2481865..2482443)
Genome map
AA seq 192 aa AA seqDB search
MEYSVHESAIVDEGATIGEGSRIWHFSHVCAGAQIGSNCSLGQNVFVGNKVIIGNNCKIQ
NNVSVYDNVTLEDGVFCGPSMVFTNVYNPRSFIERKNEYRDTLIKKGATLGANCTIVCGV
TVGSYAFVGAGAVVNKDVPAFALMVGVPAQQIGWMSAFGEQINLPLEGVGEYACPHSGQH
YILNGNRLELVS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaatactctgttcacgaaagcgccattgtggatgaaggggctacaatcggagaagga
tcccgtatctggcacttttctcatgtctgtgcgggcgcgcagatcggaagcaactgctca
ctaggccagaatgtctttgttggtaacaaagtcattattggcaataactgcaaaattcaa
aataacgtatcagtatacgataacgtaacgctggaagatggggtgttctgtggtcctagt
atggtattcaccaatgtgtacaaccctcgttcgttcatcgaaaggaagaacgaataccgt
gacacgctgatcaagaaaggcgcgacgctgggcgcaaattgcacaatagtatgtggtgtt
acggtcggatcctatgcctttgttggtgcaggtgctgttgtgaataaggatgtcccggcg
tttgctttgatggtcggcgttcccgcgcagcaaatcggctggatgagtgcgtttggcgag
cagataaatctgcccttggaaggtgtcggcgaatatgcctgcccgcacagtggacagcac
tacatccttaatggcaacagactggagctagtgagctaa

DBGET integrated database retrieval system