KEGG   Sedimenticola thiotaurini: AAY24_14040Help
Entry
AAY24_14040       CDS       T03943                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
seds  Sedimenticola thiotaurini
Pathway
seds00270  Cysteine and methionine metabolism
seds00920  Sulfur metabolism
seds01100  Metabolic pathways
seds01110  Biosynthesis of secondary metabolites
seds01130  Biosynthesis of antibiotics
seds01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seds00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AAY24_14040
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AAY24_14040
Enzymes [BR:seds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AAY24_14040
    2.3.1.46  homoserine O-succinyltransferase
     AAY24_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase
Motif
Other DBs
NCBI-ProteinID: AKH21299
UniProt: A0A0F7K138
Position
complement(3064163..3065245)
Genome map
AA seq 360 aa AA seqDB search
MPLVSHNNLPTFERLRKAGQTVLEPQRARHQDIRELHIGLLNMMPDGALEPTERQFFQLI
GESNPIAQFYVHPFTLDELPRGDKARRHIDQYYEPLEKIQQDGLDALIITGATPTRPRLA
DEPFWEPLKRVVAWAHENVTSTLCSCLATHAVLEARHATPRKPLGFKRWGVYPHRVVDRV
HPLVNDVNTRFDVPHSRFNEISRQQFEEAGLHILVESEVAGVHLAVSEDGFRMVYFQGHP
EYETISLLKEYKREVMQFAAGKRLTYPPFPDNYFMPRVQAIFNEYQLYLQRALQEGTEPP
EFPEQLISAELDNTWHDTAEGIVGNWMGLVYQVTHRERHLPFMEGVDPNNPLNLKWQDAG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccactggtatcacacaataacctgccaactttcgagcgtctgcgaaaagccggacag
acggtactggagccgcagcgggcccggcaccaggatatccgtgagctgcatatcggcctg
ctcaacatgatgccggacggggcactggagccgaccgagcgccagttcttccagctgatc
ggtgagagcaacccgatcgcccagttctatgtccaccccttcactctggacgagttgccc
cggggcgacaaggcacgccggcatatcgaccagtactacgagccgctggagaagatccag
caggatggcctggacgccctgatcatcaccggcgccacaccaacccgtccccggctggcc
gacgaaccgttctgggaaccgctgaaacgggtggtggcctgggcccatgagaacgtcacc
tcgaccctctgctcctgcctggccacccatgcggtactggaagcgcgccacgcaacaccg
cgcaaaccgctcggcttcaagcgctggggtgtctatccgcaccgggtggtggatcgggtt
caccccctggtgaacgatgtgaacacccgcttcgatgtgccccactcccgtttcaacgag
atatcgcgccagcagttcgaggaggccggtctgcacattctggtggagagcgaagtggcc
ggtgtccacctggcggtcagtgaggacggcttccgcatggtctatttccagggtcatccg
gagtacgaaaccatcagcctgcttaaagagtacaagcgcgaggtgatgcagtttgccgcc
ggcaaacggctcacctacccacccttcccggacaactacttcatgccccgggtgcaggcc
atattcaatgagtaccagctctacctgcagcgcgcgttgcaggaggggacggagccgccg
gagtttccggaacagctgatcagcgcggagctggacaacacctggcacgataccgcggaa
ggcatcgtcggcaactggatgggtctggtctaccaggtcacccatcgggagcgtcatctg
ccgtttatggaaggggtcgacccgaacaatccgctcaatctcaagtggcaggatgccggc
tga

DBGET integrated database retrieval system