KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0094Help
Entry
SNSL254_A0094     CDS       T00739                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SNSL254_A0094 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACF61948
UniProt: B4T6L5
Position
complement(102248..102625)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaact
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcaaggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system