KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0305
Entry
SNSL254_A0305     CDS       T00739                                 

Definition
(GenBank) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:see00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SNSL254_A0305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_A0305
Secretion system [BR:see02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SNSL254_A0305
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACF62707
UniProt: A0A0H3BNU5
Structure
PDB: 
5XEU

Position
320859..321344
AA seq 161 aa
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEH
YIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIA
SRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcttatgacatttttctgaaaattgacggcattgacggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggtctcggttccggtaaggtctccgtcactaatctttcatttgaacat
tacatcgatcgcgccagcccgaacctgttcaaatactgctcttccggtaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtacact
ttcacagatctgattattgcaatggtatcgcctagcggaagccagggaggggaaattgcg
tctcgcgaatcaattgaactctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system