KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0319
Entry
SNSL254_A0319     CDS       T00739                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:see00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SNSL254_A0319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_A0319
Secretion system [BR:see02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SNSL254_A0319
SSDB
Motif
Pfam: Phage_GPD Phage_base_V T3SSipB
Other DBs
NCBI-ProteinID: ACF61378
UniProt: A0A0H3BKI7
Position
333121..335310
AA seq 729 aa
MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQE
IWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLPTSE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtataggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcggaagccgccgtggaacaggctgcgggatcgctgtttggcgcattgccggagcca
tcaggactggtgaaagccgcggtggcagcggcgcaggctgccgccgccgcaggtatggcg
caggatgcggtatcggccatcgtctctgctgttgcaggcgggccgggggcgcataatgtg
acggtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggc
gaaacattaagtgaactgttcagctatgtggtacagctaaaaacgcccgacaccctgaat
ctgggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctg
tgcgtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcg
gcgcgggtggtgggccatgaagggcgttcggttacctatgagctgcgtatggagccgtgg
gtaaaactgctgacccataccagcgactacaaagcattccagaataaaaccgtggtggat
attctggatgaagtgctggcggaatacccctacccggtggaaaagcggctggtggaaagc
tacccggtacgtacctggcaggtgcagtacggtgaaactgattttgattttcttcagcga
ctgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacgctg
gtgctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtgg
caccaggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagt
ctgcggactggccagtgggtgctggatgatttcgattttacgaagccacgttcattgctg
gcaaacaccgtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtgg
ccgggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcg
cagcgcagccccggcagtcgggtgctggggggagggaatatccgcacactcatgaccggt
tataccttcacgctggaaaactatcccactgccgaagtcaatcaggaatacctgctgatg
cagaccttgctgtttgtgcaggacaacgcgcagcacagcgggcaggaccagcactttacc
ttttccacccgttttgaactgcaccccacccgtgaggtgttccgcccgcagcggacggtg
agcaaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccaggaa
atctggacggatcagtacgggcgggtaaaggtacagtttggctgggatcgctacggcaaa
atggatgaaaacagctcctgctggatacgcgtcagctacccgtgggcgggcaaaggcttc
gggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgat
ccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccaccgtgggga
ctgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggccaacg
aacggcaacatgctgcgttttgacgacaaaaccggcgcggaggaagtgaagttccacgcg
gaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggatcgc
actaaaaccattattaaaaatgaaaccaacagtattggtgaggacagaaacaccacggta
acgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccacttat
cgtttagatgttggcgatcaattcacgcttcgctgcggcaatgcggcgcttgttttacat
aaggacggctccattgagttttgtggcaagcaactgatgttacataccagcgatgtcatg
caactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgccgat
gatattgccccccttcccacctctgagtga

DBGET integrated database retrieval system