KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1400Help
Entry
SNSL254_A1400     CDS       T00739                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00010  Glycolysis / Gluconeogenesis
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNSL254_A1400
Enzymes [BR:see01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SNSL254_A1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACF62863
UniProt: A0A0H3BP55
Structure
PDB: 

Position
complement(1369444..1370328)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFE
LQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGL
GDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctcccggttatcgaacagcttacccctgtcctttcccgt
cgtcagcttgatgacctggatctgatcgtcgttgaccatccgcaggtgaaagcctctttt
gcattacagggcgcgcaccttctctcctggaaacccgttggcgaggaagaggtattgtgg
ctcagtaataatacgcctttcaaaaccggcgtggcgctacgcggcggcgtaccgatctgc
tggccctggtttggacctgcggctcaacagggtctgccgtcacacggctttgcgcgtaat
cttccgtgggcgctaaaagcgcataatgaagatgataatggcgtaatgctgacatttgag
ctgcaaagcagtgaggccacccggaaatactggccgcacgatttcacgctgctggctcgt
tttaaagtgggtaaaacctgtgaaattgaactggaagcgcatggcgaatttgcaaccaca
tccgcgctccacagctattttaacgttggcgacatcgccaacgttaaggtcagcggactc
ggcgatcggtttattgataaagttaacgacgctaaagaaggtgtcctgaccgacggtata
caaacctttccggaccgtaccgatcgcgtttacctcaatcctgaagcatgtagcgtgatc
cacgatgcgacattaaaccgcacgattgatgtggtccaccaccatcaccttaacgtcgta
ggctggaaccctggcccggcgttgtccgtcagcatgggcgacatgccggatgacggctat
aaaacgtttgtctgcgttgaaacggtttacgctactgcgccgcaacaagccacagaagaa
aaaccctctcgtctggcgcagactatctgcgtcgctaaacgctaa

DBGET integrated database retrieval system