KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A3251Help
Entry
SNSL254_A3251     CDS       T00739                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00071  Fatty acid degradation
see00280  Valine, leucine and isoleucine degradation
see00310  Lysine degradation
see00362  Benzoate degradation
see00380  Tryptophan metabolism
see00620  Pyruvate metabolism
see00630  Glyoxylate and dicarboxylate metabolism
see00640  Propanoate metabolism
see00650  Butanoate metabolism
see00900  Terpenoid backbone biosynthesis
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
see01200  Carbon metabolism
see01212  Fatty acid metabolism
see02020  Two-component system
Brite
KEGG Orthology (KO) [BR:see00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNSL254_A3251
   00630 Glyoxylate and dicarboxylate metabolism
    SNSL254_A3251
   00640 Propanoate metabolism
    SNSL254_A3251
   00650 Butanoate metabolism
    SNSL254_A3251
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SNSL254_A3251
   00072 Synthesis and degradation of ketone bodies
    SNSL254_A3251
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SNSL254_A3251
   00310 Lysine degradation
    SNSL254_A3251
   00380 Tryptophan metabolism
    SNSL254_A3251
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SNSL254_A3251
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SNSL254_A3251
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SNSL254_A3251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:see04147]
    SNSL254_A3251
Enzymes [BR:see01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SNSL254_A3251
Exosome [BR:see04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNSL254_A3251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACF65485
UniProt: A0A0H3BVS9
Position
complement(3163996..3165174)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccggacgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggctgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggcctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system