KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4219Help
Entry
SNSL254_A4219     CDS       T00739                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00860  Porphyrin and chlorophyll metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
Module
see_M00121  Heme biosynthesis, glutamate => heme
see_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SNSL254_A4219 (hemD)
Enzymes [BR:see01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SNSL254_A4219 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACF65116
UniProt: A0A0H3BVH1
Position
complement(4110622..4111362)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLAENDLVFALS
QHAVAFAHAQLQRDGRNWPASPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPEWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcgttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggtcgggagcta
cccaccctggccgaccgcctggcgacgctcgcggaaaacgatctggtttttgccctttca
cagcacgctgtcgcctttgctcacgcccagctccagcgggatggtcgaaactggcctgcg
tcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctgattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagctcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acgcttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactcccgagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgaacgtctggcgcac
ctcgcccgggagctgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system