KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4237Help
Entry
SNSL254_A4237     CDS       T00739                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00564  Glycerophospholipid metabolism
see00565  Ether lipid metabolism
see00590  Arachidonic acid metabolism
see00592  alpha-Linolenic acid metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNSL254_A4237
   00565 Ether lipid metabolism
    SNSL254_A4237
   00590 Arachidonic acid metabolism
    SNSL254_A4237
   00591 Linoleic acid metabolism
    SNSL254_A4237
   00592 alpha-Linolenic acid metabolism
    SNSL254_A4237
Enzymes [BR:see01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SNSL254_A4237
    3.1.1.32  phospholipase A1
     SNSL254_A4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACF64878
UniProt: A0A0H3BUV9
Structure
PDB: 

Position
4126382..4127251
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aatcatgactctaacggacgttcggatcccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggc
agtaccgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccag
gtgtacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system