KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0075Help
Entry
SNSL254_p_0075    CDS       T00739                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0075
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraK
Motif
Other DBs
NCBI-ProteinID: ABO41041
UniProt: A0A0H3ACW0
Position
pSN254:55663..56580
Genome map
AA seq 305 aa AA seqDB search
MKNNAKLSLLALSLALGTSMAYASDDIPVVPASVMKKDVPAPVTSGQSSHEVVGSMNENP
LLTMKPGVNQIIPIAVGHPNRIVTPFSNPEIVSTSLTGATDNGQCGEVCIKENVVYVATD
KQYPVTMFITEKGSEAQALSLTMVPRRIPPREVFLKLDGGVGITGAFANTKAETWEQSQP
YVETIRSVFRKIALGEVPQGYTLNRIPAGAAVPSCAHPGVKVDFSKGQYMMGHHLNVFIG
VALNVSDQPIEFKEALCGSWDVAAVTTWPLNVLEPGQKTEIYVAKKQKRGLAPTSKRPSL
LGGAQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaacgctaaactttcgctcctggcgctgtccttggcgcttggaacttcaatg
gcctatgcctcggatgacattcctgttgtcccggccagtgttatgaaaaaggatgttcct
gcccctgtgacgtcaggacaaagctcccatgaggttgtgggcagcatgaatgaaaacccc
ttactgacgatgaagccgggggttaaccagatcatcccgatagccgttggtcatccgaac
cgaatcgtcacgcctttcagcaatcctgagatcgtttcaacatctctgaccggggcgacg
gataacggccagtgtggtgaggtctgcatcaaagagaatgtggtctatgtcgccacggat
aagcagtatccggtgactatgttcattactgaaaaaggctcggaagcccaagctctcagc
ctgacgatggttccccgtcgtattccgcccagagaagtctttctcaagctcgatggtggt
gtaggtatcactggtgcttttgccaataccaaggctgagacctgggaacagagccagcct
tatgtcgaaaccatccggtcggtattccgcaagattgctcttggtgaagtccctcaaggt
tacacgttgaaccgcatccctgctggtgctgcggtgccgagctgcgctcatcctggggta
aaggtggatttcagcaaggggcaatacatgatgggccaccaccttaacgtgttcatcggt
gtcgccctgaacgtctctgatcagcctattgagttcaaagaggcgttgtgtgggagctgg
gatgtggctgcggtgactacgtggccgcttaacgtgcttgagcccggccagaagacggag
atctatgtggcgaagaagcagaagcgtggtctcgcaccaacgtctaagcgtccatcgctg
ctgggaggtgcccaatga

DBGET integrated database retrieval system