KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0076Help
Entry
SNSL254_p_0076    CDS       T00739                                 

Gene name
traB
Definition
(GenBank) type IV conjugative transfer system protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0076 (traB)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0076 (traB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI bZIP_1 Wtap DUF1640 Cep57_CLD_2 DUF1732 DUF677 Phage_GPO DUF2935 EntA_Immun HALZ CENP-F_leu_zip YabA FlaC_arch
Motif
Other DBs
NCBI-ProteinID: ABO41084
UniProt: A0A0H3ACX7
Position
pSN254:56577..57893
Genome map
AA seq 438 aa AA seqDB search
MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGRQETIKHVLTDKNTRE
IGIDSLSADVKMVSRENSDLKKELERVKKELEETKTTAGKSSDVGREMTRLRQDLDRLTQ
KNMELAKKVETGAAGGKTSSSSEDARADVNGASGGDGQFMEKKLDYKDPASFFRDAPLPD
SKGGAPATGKGDGRDATKPGIQIVSYSQKAPEVEEKDNKDDESIYLPSGSILTGVLINGM
DAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIVSGYGDLSSERAYLRGETFSC
VRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKSLMAGFLGGVSEAFDVNPVPV
VSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFYIDMAEGIFPVIEVDAGRQVDI
IVTKGTKLQIRSTGGTKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgattttggacacagttagaccccaacaagaagcgttgggtgtctatcgct
ggcggcgtcttcgttctttttgcggtcgtgacaatgttctctggtgaacccaagaaagaa
gagaagcgcggtcgccaagaaaccatcaagcacgttctcacagacaaaaacacccgtgag
atcgggatagattcgttgtctgccgatgtgaagatggtgtctcgtgaaaactccgacctg
aaaaaggagctggaacgagtcaagaaagagctggaggaaaccaaaaccactgccgggaaa
tccagtgatgttggccgtgagatgacccgccttcgtcaagatttggaccgcctgacccag
aagaacatggaattggctaagaaagtcgaaaccggcgctgctggtggaaaaacatcctct
tcatcagaggatgccagagccgatgttaatggtgcatctggtggtgatggtcagttcatg
gagaaaaagctcgactacaaagatcctgcatccttttttcgggacgcaccgcttcctgac
tcgaagggtggggctcctgcaactggcaagggagacggtcgtgatgcaactaaaccaggc
atccaaatagtgagctactcgcagaaagcgccagaagttgaagagaaggacaacaaggat
gatgagtctatctacctaccttctggctccatcctgacaggggtgctcatcaacggtatg
gacgcaccaacatctcaaggtgctcgtcgagatccgttcccttcgaccctcaggattcag
aaagaggctattttgcctaaccgcttccgtgcggatgttcgtgagtgcttcctgattgtt
tcaggctatggagatctcagttcagagcgagcgtacctgcgtggcgagaccttctcgtgc
gttcgggatgatgggggtgtcatagaagcgaagctggattcctatgcagtgggtgaagac
ggtaaggccggtgtccgtggtcgcgtcgtatcgaagcaggggcaaatcatcgccaagagc
ttgatggcaggcttccttggtggcgtttccgaagcctttgacgtcaatcctgtgccggtc
gttagcactaaccctggctcaaatacccagtaccagtctgtgttctccgaccagatgttg
cagggagcagcagtgaagggggccagtaaggcgctagatcgcatcgctcagttctatatc
gacatggccgaaggcatcttccctgttatcgaggtcgatgctggccgtcaggtagacatc
atcgtgaccaaaggaaccaagctacaaattcgttccaccgggggaaccaagaaatga

DBGET integrated database retrieval system