KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0077
Entry
SNSL254_p_0077    CDS       T00739                                 

Gene name
traV
Definition
(GenBank) type IV conjugative transfer system protein TraV
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0077 (traV)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0077 (traV)
SSDB
Motif
Pfam: TraV UAF_Rrn10
Other DBs
NCBI-ProteinID: ABO41175
UniProt: A0A0H3AEJ2
Position
pSN254:57890..58468
AA seq 192 aa
MKNLNILTRKGSSRGEAQKEQAVRSAKMLGVGAALLILSGCSTFNIGKDEYSCPGMPNGV
QCMSARDVYAATNDGNVPRPMKPEEVEAKAEADGEGSSNVSANSSSSGDPVIDNYVAPRL
PDRPIPIRTPAQVMRIWVAPWEDTNGDLIVTGYVYTEIEPRRWVIGDGTPQSEPVLRPLQ
TVQHEPKSETTK
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaaaaatttgaacattttgaccagaaagggcagttccagaggcgaggctcaaaaggaa
caggcagtaagatccgcaaagatgttgggggtgggtgcagcgctacttattttgtcgggc
tgttcgacgttcaacatcggcaaggatgagtatagctgtccgggaatgccgaatggtgtt
cagtgtatgtcagcgcgagacgtttacgccgcaaccaatgacggaaatgtcccgcgtcca
atgaaaccagaggaagtcgaggccaaagcggaagcggatggcgaaggttcctcaaacgtt
tcagcgaactcatctagctccggagacccggtgattgacaactatgtcgcaccgcgtctt
ccggatcgcccgattccaattcgtacaccagcacaggttatgcggatttgggtagctccc
tgggaggacaccaatggtgatctcatcgtgacagggtatgtctataccgaaatcgaaccg
cgcaggtgggtgattggggatggcacaccgcaaagtgagccagttttgagaccgctgcaa
acggtacaacacgaaccgaagtctgaaacaaccaaatag

DBGET integrated database retrieval system