KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0078Help
Entry
SNSL254_p_0078    CDS       T00739                                 

Gene name
traA
Definition
(GenBank) type IV conjugative transfer system protein TraA
  KO
K12069  conjugal transfer pilus assembly protein TraA
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0078 (traA)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0078 (traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ABO41052
UniProt: A0A0H3AC12
Position
pSN254:58481..58864
Genome map
AA seq 127 aa AA seqDB search
MNANQLANASSKNNALFLFLGLMVVAFLLVPDQAHAGTGGTAFDDVWVTLKDWTQGTLGR
IVAGAMILVGVVGGIARQSLMAFAMGIGGGMGLYNSPTVVESIMSATLEHAEKVIPAVVQ
LSNGLGV
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaatcagttggcgaatgcctcaagtaaaaacaacgcactcttcctcttcctg
gggttgatggtggtagccttcctgctcgtgccggatcaggcccacgctggtactggtggt
acagcgtttgacgacgtatgggtaactctcaaggattggacccaaggtactttgggtcga
atcgttgcgggtgcgatgatcctggtcggtgttgttggtggtatcgctcgccagagcctc
atggctttcgctatgggtatcggtggcggtatgggcctgtacaactccccgaccgtagtg
gaatccatcatgtctgctactctggaacatgcagagaaggtcatcccggctgttgtgcaa
ctcagcaatggcctgggggtgtaa

DBGET integrated database retrieval system