KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0098Help
Entry
SNSL254_p_0098    CDS       T00739                                 

Gene name
traW
Definition
(GenBank) type IV conjugative transfer system protein TraW
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0098 (traW)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0098 (traW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC_Ftype
Motif
Other DBs
NCBI-ProteinID: ABO41200
UniProt: A0A0H3AEM7
Position
pSN254:84789..86054
Genome map
AA seq 421 aa AA seqDB search
MIRSLAAHIPCSKSVLVALMFSVAGGAYAQESPLTEQDKALIEQGKQIAQKAQKMEMPSL
LQNQHMDEAQAEAKAFFKQLQTTNPTLKEMHRKQAEKGIYSDHRILVFASLSLGEQGLDD
VLTAVSGQPDSVIVFRGIPEGMNLGQGVKAIQALAAKKDPVPNIIINPTLFKTYNITAVP
TIVMLEDEPLPGEQPNVVAQVSGLSDPVWLAREVDNGEKGDLGVKGPVEKISEPDLIDVA
KKRLANIDWEEKKKQAIERFWTKQNFNELPRAPKSRTREIDPSVMITSDISTPDGTVFAH
AGDVINPLCDPKEVCKPGTRPFTQAVVVFDPLDKKQMELLAKKLPEIKLEPGVQRITYIA
TEFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHTPSVITARGKKFVVRELAEEGG
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatcagatcattggccgcgcatatcccctgttctaagagcgttctggtggcgttgatg
ttctctgtggctggcggggcatacgctcaagagtctccgctcacagagcaggataaggcg
cttattgagcaaggaaagcaaattgcccaaaaggcccagaagatggaaatgccatctctg
ttgcaaaaccaacacatggacgaggctcaggccgaagccaaggcatttttcaagcagctc
caaactactaacccaacgctcaaggagatgcaccggaaacaggctgaaaagggtatctac
tctgaccatcggatactggttttcgcctcgttgtctcttggcgaacaggggttagatgac
gtcctaacggcggtgtcaggccagcctgattctgtaattgtgttccgtggcatcccggaa
ggaatgaacttggggcagggagttaaagctattcaggcgctcgcggccaaaaaagaccca
gtgccgaacatcatcatcaaccctacgttgttcaaaacgtacaacatcacagccgttccc
acgattgtgatgctggaggatgagccgctgcctggcgaacaaccaaacgtcgtcgcccag
gtctccgggttgtccgacccggtatggttggctcgggaagtggataacggagaaaaaggc
gatctcggcgttaaggggccggtggagaaaatcagtgagccagaccttattgatgttgcc
aagaaacgccttgccaatatcgactgggaagagaagaagaaacaggctatagagcgcttc
tggaccaagcagaatttcaatgagctgccaagagcgccaaaatctcgaacacgagaaatt
gaccctagcgtcatgatcaccagtgacatcagcactccggatggcactgtgttcgctcac
gcgggtgacgtgatcaacccattgtgcgatccgaaggaagtttgcaagcctggaacgcgg
ccatttacccaagcggtcgtagttttcgacccgctggacaaaaagcaaatggaactactc
gccaagaagctgcctgaaatcaagctggagcctggcgtacaacggatcacctatatcgcc
acagagttcgacaaagacaaaggctgggattcctacaagagtgtcaccgacaactttgac
gcgccggtatatctgctgacgccagatctgattacccggttcgagctggagcacacaccg
agcgtcattactgccagaggcaagaagtttgttgtccgcgaacttgctgaggagggcggt
gaatga

DBGET integrated database retrieval system