KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0101
Entry
SNSL254_p_0101    CDS       T00739                                 

Gene name
traN
Definition
(GenBank) type IV conjugative transfer system protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0101 (traN)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0101 (traN)
SSDB
Motif
Pfam: TraN DUF3391 ZYG-11_interact TraG_N Phage_coatGP8
Other DBs
NCBI-ProteinID: ABO41067
UniProt: A0A0H3AC27
Position
pSN254:87842..90637
AA seq 931 aa
MRSHNYFMKAVASLLTVTMSALPIHSYANGSQDQDITAVGKEAQAFGQNLSNSFKSSSGT
VQDGTISMPTLKDGQFQMNGGSQINVNDLFPGTSGTNNKPDSYYFPDANKPDVGGLQGIY
DSGDDMDSVGNNAKGSLWSDANSANPSISGAAYKVLLDASNRSRPDFSNDPVLNLSKKTY
EDMDLIAGGFGDCSAETTINQNTINAHIPEYERCQRVVDQSADCEVVHDYDASVVKHYDG
PYNLKSCGEGCTELWIGRVGDNYWSGNCKIYEEYTRVQVSNPDAIVSATLEYAKWDDYMQ
VWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWERNPNVDVTPYFKNVKDGDVVTFKIR
VSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMDSAKGVVDGFAEGEITCIDDPTDATG
CTVINGIKVCESQLKPSPLPGIPKLCKKVRVKADYDFYKGQMDCWTDPQGETHCPVNTGG
NLDSCQKYEENPQCGFISSKCVDGAQGSSGTCYVHEDTYDCGTDVSVPTLEKETEYQCGG
PIRCMGDDCLDLTKTQSTDFARATALLNAAQFMTQDMSCTGQDGDDNPTGDENVICSAFA
GEAGECKIAVGGVSDCCEKPTNISLADYLNLIMAVPKLDGAVMGLTDGNALKGAYQVLRE
PALQGWTEVTKPFTSYIENVSGAVDSFFQPVEQFVDQLIDQLKEQVKEVMMDVMKSAGQD
AATEQAAAAASEQAAEAMMETATTWLSTAMTIYTVYVVAMVMIQMIYKCEEEEFTMNAKR
ALKNCTYVGSYCKSKVLGACIEKREAYCCFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEG
IPLDKIAEIDWSKINLDEWLGILQQNGKFPDPASINLDSLTGAGNDFNIDGTRKNAQERA
LERLEGIDIDAKRKEATNSIDPQTGAPTGGG
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgcgaagtcataattactttatgaaagctgtggcctcgctgttgacagtaaccatgtct
gcgctgccgatacattcctacgctaacggtagccaagaccaggacatcacagcggtgggt
aaagaggcccaggctttcggacaaaacctctcaaactcattcaagtcgagctcggggact
gtgcaagatggcacaatctctatgccgacgttgaaagacggtcaattccaaatgaacggg
gggagtcagattaatgtcaatgatctattccccggaacgagcgggaccaacaataaacct
gatagttattacttccctgatgccaataaacctgatgtgggcggtctgcaaggcatttac
gactctggcgatgacatggacagcgtggggaataatgcaaaagggtcgctgtggagtgat
gccaatagtgctaatccatcaatctctggtgcggcatacaaggttcttctcgatgcctct
aatcgatcacgccctgatttcagtaatgacccggtactaaatctaagcaaaaagacctat
gaggatatggacctcatcgcaggtggctttggggattgttctgccgaaacaaccatcaat
cagaatactatcaacgcccacattccagagtatgaacggtgtcagcgtgttgtagatcaa
agcgcggactgtgaggttgtccatgactacgacgcctctgtggtgaagcactatgatggt
ccatataacctcaaatcttgtggagaaggctgtactgagttgtggattggtcgagtgggg
gacaactactggagtggtaactgcaagatttatgaggagtacacgcgggtccaagtcagc
aatccagatgccatagtgtctgcaacgcttgaatacgccaagtgggatgactacatgcaa
gtgtgggtcggtaagtccggccaagagactaaagtgtggtctggcccagatggcaacttc
cctccagaaacagccggtagatgtgagctctccacgagttgggagcgaaaccctaatgtt
gatgtcactccctattttaagaacgtgaaagatggtgatgttgttacgtttaagatccgc
gtttcagtaagtggcgaaggtgagggttttggccgcataaaactccgctatgacccatcg
aaagccattaccaaggatgagtgggctccacagagctgcatggattcagccaaaggggtg
gtagatggttttgcggaaggcgagatcacatgtatagatgacccgactgatgctactggc
tgcacagtcatcaatgggatcaaagtttgcgaatctcaactcaagccgtcacctttgcct
ggtattccaaaactatgcaaaaaggttcgagttaaagctgactatgacttctataagggg
caaatggactgctggacagaccctcaaggtgaaacgcactgtccggtaaacacgggcggg
aatctcgatagctgtcagaaatatgaagaaaaccctcagtgcggcttcatcagttccaaa
tgtgttgatggtgctcagggaagttctggtacgtgctacgtccacgaggatacttatgac
tgtggtacagatgtttctgttccgaccttggaaaaggaaactgagtaccagtgcggtggg
cctatacgctgcatgggagatgactgccttgatttgaccaaaacacaaagcactgatttt
gctcgcgctactgcgttgctcaatgcagcccaattcatgacgcaggatatgagctgcaca
ggccaagatggggatgacaatcctaccggggatgaaaacgttatttgctctgcttttgca
ggggaagctggcgaatgcaagatagctgttgggggagtttctgattgctgtgaaaagcca
accaatatatctcttgccgattatctgaacctaataatggccgttccaaagctcgatggc
gcagtgatggggctgactgatggtaatgcgcttaaaggtgcttatcaggtacttagggaa
cctgcccttcaagggtggacagaagtcacaaaaccgttcacaagttatatagagaacgtt
tcaggtgctgttgattcgttcttccagcctgtagagcagtttgttgatcaactcattgac
cagctcaaagagcaagtcaaagaagtgatgatggatgtcatgaaatcagcaggccaagat
gcagcaacagagcaggcggctgccgcagcatctgaacaagctgccgaagcaatgatggag
actgcgacaacatggcttagcactgccatgacgatatataccgtctatgtcgttgcgatg
gtgatgatccagatgatttataagtgcgaggaagaagagttcactatgaacgcaaaaaga
gcgctcaagaattgcacctatgtaggctcttattgtaaatctaaggtgttgggcgcttgt
attgaaaaaagagaagcgtattgctgcttcaattctccgctctctcgtattatacaagaa
caggttcgccctcaattggggcagaactttggagaccccaaaaatcctcagtgtgaaggg
attccactagataaaattgccgaaattgattggagcaaaattaatttggatgagtggctt
gggatattacagcagaacggtaaattccctgatccggcctcaataaatctcgactcgctg
actggagcagggaatgacttcaatattgacgggacgcggaagaatgctcaggaaagggcg
ttggagcggttggaagggattgatattgacgcgaagcgaaaagaggcgacaaacagcata
gaccctcaaacaggcgcgccaactggtggtggataa

DBGET integrated database retrieval system