KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0188Help
Entry
SNSL254_p_0188    CDS       T00739                                 

Gene name
traH
Definition
(GenBank) type IV conjugative transfer system protein TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
KEGG Orthology (KO) [BR:see00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:see02044]
    SNSL254_p_0188 (traH)
Secretion system [BR:see02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SNSL254_p_0188 (traH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraH
Motif
Other DBs
NCBI-ProteinID: ABO41051
UniProt: A0A0H3ACX3
Position
pSN254:166376..167809
Genome map
AA seq 477 aa AA seqDB search
MVTHKTLKRSLLALSVAASLVMAPTGAIAANGLQSQMDKLFNEMSNTTPPGVYESQRRGV
LAGGRFTAKTRIFDENLVSFAPPSWKAGCGGVDLFGGSLSFINADQIVQLLRAVAANAKG
YAFQLALDNVFPDGAKWIENFQKKVQALNQHLGNSCQLAQGFVNDLTSGMDLKHKTDASI
TATTSGLYEDFFGSKQETSGKSPLEELKANKPDEYNKMIGNIVWKQLKSNNANTWFQYGD
NTLLEAIMSLTGTVIIGDLVNDPNSTGTGAKTTPLTTLPGNKITLSDLISGGSVEIYSCD
SDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIYKYATNSGTLTDPEKAFVSNL
PGGIGTIVRNLSVLSQDGANLFATESSGAIALTMMYSFSEEFFRAARIAMANSKSPYKKE
ALELLAQSQQQIRAEYTILSSQYGDLASQIEKYNNLLDNIRKQKYMLATLSNPPSTN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgcacaagacattaaaaaggagcctgcttgccctgagtgtggcggccagtctc
gtcatggcaccgacaggggcgatagccgctaacggcctccaatcacagatggacaaactc
ttcaatgaaatgagcaacacaacaccacctggggtttatgaaagccaacgacgtggcgtt
ttagctggtggccggttcactgcaaagacacgaatcttcgacgagaacctggtgagcttt
gcccctccatcatggaaagctggttgcggtggtgtagatctgttcggcggttcgctttcc
ttcattaacgcggatcaaattgtccaactccttcgggctgtagcagccaacgccaagggc
tatgccttccagcttgcgctcgataacgttttcccggacggagcgaagtggatagagaac
ttccagaagaaagtgcaagcgctcaaccaacatctgggcaactcctgccagctcgctcaa
ggtttcgtgaacgacctaaccagcggcatggaccttaaacacaaaactgatgcttctata
accgcgacaacttccggcctgtatgaagacttcttcgggtccaagcaggaaaccagcggc
aagagtcctctggaagaactgaaagccaacaaacctgacgaatacaacaagatgattggc
aacatcgtctggaagcaactcaagagcaacaacgccaacacctggttccagtacggggat
aacacccttcttgaagcgatcatgtctttaaccggcacagtcatcattggtgatctggta
aacgacccgaactcaaccggcactggtgcgaaaacaacccctctgacgaccctaccaggt
aacaagatcaccttgtcagacctgatttcaggcggttctgttgagatctattcctgtgat
tctgatacgaccaactgcctgagtgctggctccagcaataaaactgtcgtgctcaaaggt
atcaagaaccagatcaccgatatgctgttaggaacaagctctacacctggtgtgatctac
aaatacgcaacgaactctggaaccttaaccgacccagaaaaggcctttgtttctaacctc
cccggagggattggcaccattgttcgtaacttgtctgtcctttcacaggacggcgctaac
ctgttcgcaacagagtcatcaggagcgatagccctgaccatgatgtatagcttctcggaa
gagttcttccgcgcagctcgcattgcgatggctaacagcaaatcaccctacaagaaagag
gcactagagcttctcgcgcaatcgcaacagcaaatccgtgctgaatacacaatcctgtcc
tctcaatacggcgatctggcaagccaaattgagaaatacaacaacctactggacaacatc
cgcaagcaaaaatacatgctggcaactttgtccaatcctcctagcacgaactaa

DBGET integrated database retrieval system