KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_005300Help
Entry
SEEB0189_005300   CDS       T02739                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seeb03016]
    SEEB0189_005300
Enzymes [BR:seeb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SEEB0189_005300
Transfer RNA biogenesis [BR:seeb03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SEEB0189_005300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGQ58132
Position
1019003..1019785
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLMIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHQA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacaggcccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggctgtaacgcagtatcgcgggctggcgacggtcgaaatggcggtgccg
accgggcgttatcccaccacgcgttatggcctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcggcttgagctgacgcaccccttcaccggacagccgttgatgattcag
gccgggttggatgaaacctggatgcaggcgctgacacagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatcaggca
taa

DBGET integrated database retrieval system